Protein Family IF07345

Metagenome Isolate
134 Members
43 Samples
120 Scaffolds
441.97 Avg Length

🧬 Representative Sequence

ID
3300042614|Ga0466712_046957|Ga0466712_046957_14264_15799
Length
496 aa
Sequence
LNNFYNYIKESIVCIYAKRYIFLKNGNSARGRDIGKFFAICYNAPMNDYRQKLNSLGLEVPSVLLPQGVDMQKWPVIACDQFTQDRDYWEKAKNAAEGSPSTLNLIIPEVFLGDGDEEQRIAGIHSAMKRYLADGVFGQPRQGFIYIERDTPYQKKRRGLIAAVDLEHYDWQPSARPLIRCTEGTVAERLPPRMDIRRGAPLELPHVMLLIDDDADELLPALGGRAQKTAPVYTSRLMMDSGSVSGWFLDAESDLSFIAEKLDALCRRSAGRYSGDDGKAGQPFLFAVGDGNHSLAAAKGIWEEYKASHSADSRGQDGLPVHACRYALVEIENIYDPAIQFEPIHRVVFDIDFDKTISLLSRLPDFSCRPVDSAQELVRLCKNPVSANCFGIISQGRYALAETSAAGIATACLQPLLDEFAGDNPQLIDYIHDEDEILRLSDGGANSPAVGILLPPVQKSGLFQTVARLGPLPRKSFSMGHSCEKRFYLECRGLFL

πŸ“Š Sample Types

Isolate 10.4%
Metagenome 89.5%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Termitidae 46.3%
Unclassified 34.1%
Kalotermitidae 14.6%
Rhinotermitidae 2.4%
Termopsidae 2.4%

🌳 Taxonomy

Archaea 0
Bacteria 129
Eukaryota 0
Viruses 0
Unclassified 5

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
3 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
4 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
5 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
6 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
11 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
12 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
13 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
14 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
15 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
18 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
19 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
20 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
21 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
22 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
23 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
24 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
25 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
26 2820020240 Unclassified Spirochaetes Nc150P3bin10 Isolate Unclassified
27 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
28 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
29 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
30 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
31 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
32 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
33 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
36 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
37 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
38 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
39 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
40 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
41 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
42 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
43 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_319366 3300042656 Bacteria 3626
2 Ga0466712_110143 3300042614 Bacteria 24560
3 Ga0466718_019266 3300042617 Bacteria 6139
4 JGI24698J34947_10002713 3300002449 Bacteria 9562
5 JGI24698J34947_10003071 3300002449 Bacteria 9039
6 JGI24698J34947_10004976 3300002449 Bacteria 7281
7 JGI24699J35502_11129259 3300002509 Bacteria 4647
8 Ga0072941_1001246 3300005201 Unclassified 30025
9 Ga0072941_1011896 3300005201 Bacteria 5567
10 Ga0072941_1013691 3300005201 Bacteria 7379
11 Ga0466704_228190 3300042643 Bacteria 1494
12 Ga0466704_563344 3300042643 Bacteria 1976
13 Ga0466712_044353 3300042614 Bacteria 3665
14 Ga0466712_127573 3300042614 Bacteria 29541
15 Ga0466720_039216 3300042607 Bacteria 3730
16 Ga0466720_139293 3300042607 Bacteria 16109
17 Ga0466698_182086 3300042610 Bacteria 27947
18 JGI24698J34947_10001090 3300002449 Bacteria 14013
19 JGI24698J34947_10041807 3300002449 Bacteria 2359
20 JGI24698J34947_10056349 3300002449 Bacteria 1954
21 JGI24698J34947_10059053 3300002449 Bacteria 1897
22 JGI24698J34947_10063571 3300002449 Bacteria 1808
23 Ga0072941_1013646 3300005201 Bacteria 7531
24 Ga0072941_1023398 3300005201 Bacteria 8964
25 Ga0466729_216422 3300042621 Bacteria 1383
26 Ga0466702_097649 3300042635 Bacteria 41168
27 Ga0466699_258915 3300042597 Bacteria 43850
28 Ga0466712_052962 3300042614 Bacteria 1463
29 Ga0466712_117871 3300042614 Bacteria 33194
30 Ga0466712_166747 3300042614 Bacteria 1839
31 Ga0466728_452197 3300042620 Bacteria 1899
32 Ga0123356_10027940 3300010049 Bacteria 5287
33 JGI24698J34947_10007756 3300002449 Bacteria 5897
34 JGI24695J34938_10001348 3300002450 Bacteria 21212
35 Ga0072941_1065244 3300005201 Bacteria 5017
36 Ga0466702_295811 3300042635 Bacteria 9267
37 Ga0466703_021430 3300042636 Bacteria 7988
38 Ga0466703_188346 3300042636 Bacteria 16583
39 Ga0466694_045469 3300042594 Bacteria 6915
40 Ga0466732_108264 3300042656 Bacteria 20151
41 Ga0466712_188368 3300042614 Bacteria 9503
42 Ga0466712_220912 3300042614 Bacteria 13104
43 Ga0466720_221717 3300042607 Unclassified 3269
44 Ga0466721_262362 3300042608 Bacteria 4666
45 Ga0123356_10002241 3300010049 Bacteria 20839
46 Ga0123356_10306546 3300010049 Bacteria 1695
47 JGI24698J34947_10010703 3300002449 Unclassified 5035
48 JGI24698J34947_10061463 3300002449 Bacteria 1849
49 JGI24695J34938_10000551 3300002450 Bacteria 36191
50 JGI24695J34938_10001017 3300002450 Bacteria 25353
51 JGI24695J34938_10021978 3300002450 Bacteria 3109
52 Ga0072941_1003798 3300005201 Bacteria 25376
53 Ga0072941_1075431 3300005201 Bacteria 3474
54 Ga0072941_1098519 3300005201 Bacteria 5652
55 Ga0466703_119542 3300042636 Bacteria 5110
56 Ga0466704_181800 3300042643 Bacteria 12386
57 Ga0415639_006599 3300038395 Bacteria 20554
58 Ga0466694_073248 3300042594 Bacteria 3199
59 Ga0466699_029399 3300042597 Bacteria 27869
60 Ga0466699_124006 3300042597 Bacteria 4685
61 Ga0466732_235836 3300042656 Bacteria 2829
62 Ga0466712_044222 3300042614 Bacteria 12135
63 Ga0466712_094815 3300042614 Bacteria 4020
64 Ga0466715_286076 3300042616 Bacteria 13194
65 Ga0466700_008796 3300042600 Bacteria 9467
66 Ga0466721_282711 3300042608 Bacteria 12550
67 Ga0123353_10026615 3300010167 Bacteria 8842
68 JGI24698J34947_10000570 3300002449 Bacteria 17571
69 JGI24698J34947_10005761 3300002449 Bacteria 6792
70 JGI24698J34947_10012980 3300002449 Unclassified 4551
71 JGI24698J34947_10019270 3300002449 Bacteria 3683
72 JGI24695J34938_10000096 3300002450 Bacteria 77675
73 JGI24695J34938_10000388 3300002450 Bacteria 43510
74 JGI24695J34938_10000674 3300002450 Bacteria 32227
75 Ga0072941_1050313 3300005201 Bacteria 11994
76 Ga0123357_10000930 3300009784 Bacteria 29783
77 Ga0466708_110435 3300042652 Bacteria 2959
78 Ga0415639_043198 3300038395 Bacteria 12841
79 Ga0466712_283784 3300042614 Bacteria 3446
80 Ga0466718_004512 3300042617 Bacteria 19951
81 Ga0466720_104079 3300042607 Unclassified 2066
82 Ga0466720_131434 3300042607 Bacteria 8947
83 Ga0123356_10429908 3300010049 Bacteria 1464
84 JGI24698J34947_10000010 3300002449 Bacteria 46965
85 JGI24698J34947_10006577 3300002449 Bacteria 6383
86 JGI24695J34938_10000350 3300002450 Bacteria 45521
87 JGI24695J34938_10001001 3300002450 Bacteria 25675
88 Ga0466703_258293 3300042636 Bacteria 4156
89 Ga0264413_100481 3300024493 Bacteria 15304
90 Ga0264413_105653 3300024493 Bacteria 17563
91 Ga0466694_075290 3300042594 Bacteria 3159
92 Ga0466694_357483 3300042594 Bacteria 1858
93 Ga0466699_214002 3300042597 Bacteria 6932
94 Ga0466732_202818 3300042656 Bacteria 1950
95 Ga0466712_195298 3300042614 Bacteria 26143
96 Ga0466720_223834 3300042607 Bacteria 5283
97 JGI24695J34938_10000926 3300002450 Bacteria 26844
98 JGI24695J34938_10004090 3300002450 Bacteria 9735
99 JGI24695J34938_10017580 3300002450 Bacteria 3597
100 JGI24699J35502_11128645 3300002509 Bacteria 4464
101 Ga0072941_1003799 3300005201 Bacteria 17029
102 Ga0072941_1024126 3300005201 Bacteria 8637
103 Ga0466702_178299 3300042635 Bacteria 15500
104 Ga0466704_095780 3300042643 Bacteria 4479
105 Ga0466704_276913 3300042643 Bacteria 2205
106 Ga0264413_118972 3300024493 Bacteria 3202
107 Ga0415639_036413 3300038395 Bacteria 7598
108 Ga0466712_046957 3300042614 Bacteria 20217
109 Ga0466712_208377 3300042614 Bacteria 21122
110 Ga0466712_233319 3300042614 Bacteria 29540
111 Ga0466718_049233 3300042617 Bacteria 2401
112 Ga0466726_215553 3300042619 Bacteria 21793
113 Ga0466716_309382 3300042605 Bacteria 2457
114 Ga0123356_10009086 3300010049 Bacteria 9827
115 Ga0123356_10070866 3300010049 Bacteria 3271
116 2230969592 2228664004 Bacteria 21350
117 AustNasuHG_c1002057 3300000089 Bacteria 7259
118 JGI24698J34947_10005949 3300002449 Bacteria 6694
119 Ga0466699_201105 3300042597 Bacteria 4077
120 Ga0466699_258007 3300042597 Bacteria 27039

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF06245 DUF1015 Protein of unknown function (DUF1015) 68 402 0.85

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.