Protein Family IF07345
Metagenome
Isolate
134
Members
43
Samples
120
Scaffolds
441.97
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_046957|Ga0466712_046957_14264_15799
- Length
- 496 aa
- Sequence
- LNNFYNYIKESIVCIYAKRYIFLKNGNSARGRDIGKFFAICYNAPMNDYRQKLNSLGLEVPSVLLPQGVDMQKWPVIACDQFTQDRDYWEKAKNAAEGSPSTLNLIIPEVFLGDGDEEQRIAGIHSAMKRYLADGVFGQPRQGFIYIERDTPYQKKRRGLIAAVDLEHYDWQPSARPLIRCTEGTVAERLPPRMDIRRGAPLELPHVMLLIDDDADELLPALGGRAQKTAPVYTSRLMMDSGSVSGWFLDAESDLSFIAEKLDALCRRSAGRYSGDDGKAGQPFLFAVGDGNHSLAAAKGIWEEYKASHSADSRGQDGLPVHACRYALVEIENIYDPAIQFEPIHRVVFDIDFDKTISLLSRLPDFSCRPVDSAQELVRLCKNPVSANCFGIISQGRYALAETSAAGIATACLQPLLDEFAGDNPQLIDYIHDEDEILRLSDGGANSPAVGILLPPVQKSGLFQTVARLGPLPRKSFSMGHSCEKRFYLECRGLFL
Sample Types
Isolate
10.4%
Metagenome
89.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.3%
Unclassified
34.1%
Kalotermitidae
14.6%
Rhinotermitidae
2.4%
Termopsidae
2.4%
Taxonomy
Archaea
0
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 2 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 3 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 13 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 14 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 18 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 19 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 20 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 24 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 25 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 26 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 27 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 28 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 29 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 30 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 31 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 32 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 33 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 34 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 35 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 36 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 37 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 38 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 39 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 40 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 41 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 42 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 43 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_319366 | 3300042656 | Bacteria | 3626 |
| 2 | Ga0466712_110143 | 3300042614 | Bacteria | 24560 |
| 3 | Ga0466718_019266 | 3300042617 | Bacteria | 6139 |
| 4 | JGI24698J34947_10002713 | 3300002449 | Bacteria | 9562 |
| 5 | JGI24698J34947_10003071 | 3300002449 | Bacteria | 9039 |
| 6 | JGI24698J34947_10004976 | 3300002449 | Bacteria | 7281 |
| 7 | JGI24699J35502_11129259 | 3300002509 | Bacteria | 4647 |
| 8 | Ga0072941_1001246 | 3300005201 | Unclassified | 30025 |
| 9 | Ga0072941_1011896 | 3300005201 | Bacteria | 5567 |
| 10 | Ga0072941_1013691 | 3300005201 | Bacteria | 7379 |
| 11 | Ga0466704_228190 | 3300042643 | Bacteria | 1494 |
| 12 | Ga0466704_563344 | 3300042643 | Bacteria | 1976 |
| 13 | Ga0466712_044353 | 3300042614 | Bacteria | 3665 |
| 14 | Ga0466712_127573 | 3300042614 | Bacteria | 29541 |
| 15 | Ga0466720_039216 | 3300042607 | Bacteria | 3730 |
| 16 | Ga0466720_139293 | 3300042607 | Bacteria | 16109 |
| 17 | Ga0466698_182086 | 3300042610 | Bacteria | 27947 |
| 18 | JGI24698J34947_10001090 | 3300002449 | Bacteria | 14013 |
| 19 | JGI24698J34947_10041807 | 3300002449 | Bacteria | 2359 |
| 20 | JGI24698J34947_10056349 | 3300002449 | Bacteria | 1954 |
| 21 | JGI24698J34947_10059053 | 3300002449 | Bacteria | 1897 |
| 22 | JGI24698J34947_10063571 | 3300002449 | Bacteria | 1808 |
| 23 | Ga0072941_1013646 | 3300005201 | Bacteria | 7531 |
| 24 | Ga0072941_1023398 | 3300005201 | Bacteria | 8964 |
| 25 | Ga0466729_216422 | 3300042621 | Bacteria | 1383 |
| 26 | Ga0466702_097649 | 3300042635 | Bacteria | 41168 |
| 27 | Ga0466699_258915 | 3300042597 | Bacteria | 43850 |
| 28 | Ga0466712_052962 | 3300042614 | Bacteria | 1463 |
| 29 | Ga0466712_117871 | 3300042614 | Bacteria | 33194 |
| 30 | Ga0466712_166747 | 3300042614 | Bacteria | 1839 |
| 31 | Ga0466728_452197 | 3300042620 | Bacteria | 1899 |
| 32 | Ga0123356_10027940 | 3300010049 | Bacteria | 5287 |
| 33 | JGI24698J34947_10007756 | 3300002449 | Bacteria | 5897 |
| 34 | JGI24695J34938_10001348 | 3300002450 | Bacteria | 21212 |
| 35 | Ga0072941_1065244 | 3300005201 | Bacteria | 5017 |
| 36 | Ga0466702_295811 | 3300042635 | Bacteria | 9267 |
| 37 | Ga0466703_021430 | 3300042636 | Bacteria | 7988 |
| 38 | Ga0466703_188346 | 3300042636 | Bacteria | 16583 |
| 39 | Ga0466694_045469 | 3300042594 | Bacteria | 6915 |
| 40 | Ga0466732_108264 | 3300042656 | Bacteria | 20151 |
| 41 | Ga0466712_188368 | 3300042614 | Bacteria | 9503 |
| 42 | Ga0466712_220912 | 3300042614 | Bacteria | 13104 |
| 43 | Ga0466720_221717 | 3300042607 | Unclassified | 3269 |
| 44 | Ga0466721_262362 | 3300042608 | Bacteria | 4666 |
| 45 | Ga0123356_10002241 | 3300010049 | Bacteria | 20839 |
| 46 | Ga0123356_10306546 | 3300010049 | Bacteria | 1695 |
| 47 | JGI24698J34947_10010703 | 3300002449 | Unclassified | 5035 |
| 48 | JGI24698J34947_10061463 | 3300002449 | Bacteria | 1849 |
| 49 | JGI24695J34938_10000551 | 3300002450 | Bacteria | 36191 |
| 50 | JGI24695J34938_10001017 | 3300002450 | Bacteria | 25353 |
| 51 | JGI24695J34938_10021978 | 3300002450 | Bacteria | 3109 |
| 52 | Ga0072941_1003798 | 3300005201 | Bacteria | 25376 |
| 53 | Ga0072941_1075431 | 3300005201 | Bacteria | 3474 |
| 54 | Ga0072941_1098519 | 3300005201 | Bacteria | 5652 |
| 55 | Ga0466703_119542 | 3300042636 | Bacteria | 5110 |
| 56 | Ga0466704_181800 | 3300042643 | Bacteria | 12386 |
| 57 | Ga0415639_006599 | 3300038395 | Bacteria | 20554 |
| 58 | Ga0466694_073248 | 3300042594 | Bacteria | 3199 |
| 59 | Ga0466699_029399 | 3300042597 | Bacteria | 27869 |
| 60 | Ga0466699_124006 | 3300042597 | Bacteria | 4685 |
| 61 | Ga0466732_235836 | 3300042656 | Bacteria | 2829 |
| 62 | Ga0466712_044222 | 3300042614 | Bacteria | 12135 |
| 63 | Ga0466712_094815 | 3300042614 | Bacteria | 4020 |
| 64 | Ga0466715_286076 | 3300042616 | Bacteria | 13194 |
| 65 | Ga0466700_008796 | 3300042600 | Bacteria | 9467 |
| 66 | Ga0466721_282711 | 3300042608 | Bacteria | 12550 |
| 67 | Ga0123353_10026615 | 3300010167 | Bacteria | 8842 |
| 68 | JGI24698J34947_10000570 | 3300002449 | Bacteria | 17571 |
| 69 | JGI24698J34947_10005761 | 3300002449 | Bacteria | 6792 |
| 70 | JGI24698J34947_10012980 | 3300002449 | Unclassified | 4551 |
| 71 | JGI24698J34947_10019270 | 3300002449 | Bacteria | 3683 |
| 72 | JGI24695J34938_10000096 | 3300002450 | Bacteria | 77675 |
| 73 | JGI24695J34938_10000388 | 3300002450 | Bacteria | 43510 |
| 74 | JGI24695J34938_10000674 | 3300002450 | Bacteria | 32227 |
| 75 | Ga0072941_1050313 | 3300005201 | Bacteria | 11994 |
| 76 | Ga0123357_10000930 | 3300009784 | Bacteria | 29783 |
| 77 | Ga0466708_110435 | 3300042652 | Bacteria | 2959 |
| 78 | Ga0415639_043198 | 3300038395 | Bacteria | 12841 |
| 79 | Ga0466712_283784 | 3300042614 | Bacteria | 3446 |
| 80 | Ga0466718_004512 | 3300042617 | Bacteria | 19951 |
| 81 | Ga0466720_104079 | 3300042607 | Unclassified | 2066 |
| 82 | Ga0466720_131434 | 3300042607 | Bacteria | 8947 |
| 83 | Ga0123356_10429908 | 3300010049 | Bacteria | 1464 |
| 84 | JGI24698J34947_10000010 | 3300002449 | Bacteria | 46965 |
| 85 | JGI24698J34947_10006577 | 3300002449 | Bacteria | 6383 |
| 86 | JGI24695J34938_10000350 | 3300002450 | Bacteria | 45521 |
| 87 | JGI24695J34938_10001001 | 3300002450 | Bacteria | 25675 |
| 88 | Ga0466703_258293 | 3300042636 | Bacteria | 4156 |
| 89 | Ga0264413_100481 | 3300024493 | Bacteria | 15304 |
| 90 | Ga0264413_105653 | 3300024493 | Bacteria | 17563 |
| 91 | Ga0466694_075290 | 3300042594 | Bacteria | 3159 |
| 92 | Ga0466694_357483 | 3300042594 | Bacteria | 1858 |
| 93 | Ga0466699_214002 | 3300042597 | Bacteria | 6932 |
| 94 | Ga0466732_202818 | 3300042656 | Bacteria | 1950 |
| 95 | Ga0466712_195298 | 3300042614 | Bacteria | 26143 |
| 96 | Ga0466720_223834 | 3300042607 | Bacteria | 5283 |
| 97 | JGI24695J34938_10000926 | 3300002450 | Bacteria | 26844 |
| 98 | JGI24695J34938_10004090 | 3300002450 | Bacteria | 9735 |
| 99 | JGI24695J34938_10017580 | 3300002450 | Bacteria | 3597 |
| 100 | JGI24699J35502_11128645 | 3300002509 | Bacteria | 4464 |
| 101 | Ga0072941_1003799 | 3300005201 | Bacteria | 17029 |
| 102 | Ga0072941_1024126 | 3300005201 | Bacteria | 8637 |
| 103 | Ga0466702_178299 | 3300042635 | Bacteria | 15500 |
| 104 | Ga0466704_095780 | 3300042643 | Bacteria | 4479 |
| 105 | Ga0466704_276913 | 3300042643 | Bacteria | 2205 |
| 106 | Ga0264413_118972 | 3300024493 | Bacteria | 3202 |
| 107 | Ga0415639_036413 | 3300038395 | Bacteria | 7598 |
| 108 | Ga0466712_046957 | 3300042614 | Bacteria | 20217 |
| 109 | Ga0466712_208377 | 3300042614 | Bacteria | 21122 |
| 110 | Ga0466712_233319 | 3300042614 | Bacteria | 29540 |
| 111 | Ga0466718_049233 | 3300042617 | Bacteria | 2401 |
| 112 | Ga0466726_215553 | 3300042619 | Bacteria | 21793 |
| 113 | Ga0466716_309382 | 3300042605 | Bacteria | 2457 |
| 114 | Ga0123356_10009086 | 3300010049 | Bacteria | 9827 |
| 115 | Ga0123356_10070866 | 3300010049 | Bacteria | 3271 |
| 116 | 2230969592 | 2228664004 | Bacteria | 21350 |
| 117 | AustNasuHG_c1002057 | 3300000089 | Bacteria | 7259 |
| 118 | JGI24698J34947_10005949 | 3300002449 | Bacteria | 6694 |
| 119 | Ga0466699_201105 | 3300042597 | Bacteria | 4077 |
| 120 | Ga0466699_258007 | 3300042597 | Bacteria | 27039 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF06245 | DUF1015 | Protein of unknown function (DUF1015) | 68 | 402 | 0.85 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.