Protein Family IF07326
Metagenome
Metatranscriptome
Isolate
127
Members
35
Samples
125
Scaffolds
62.63
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_001869|Ga0466712_001869_905_1126
- Length
- 73 aa
- Sequence
- MKAYTHEMDYSDLNVDQIVKEVYAAKAEGRTRPATKQEIMRIRLAALSAIVRNMQDIVEKYHELVSACHAESV
Sample Types
Isolate
1.6%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
64.7%
Kalotermitidae
26.5%
Unclassified
5.9%
Rhinotermitidae
2.9%
Taxonomy
Archaea
2
Bacteria
71
Eukaryota
0
Viruses
0
Unclassified
54
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 9 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 13 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 14 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 15 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 16 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 17 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 20 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 23 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 24 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 25 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 26 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 30 | 3300022232 | Termite gut microbial communities from Cavitermes sp. nest - French Guiana - 28-9 mRNA | Metatranscriptome | Termitidae |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 35 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_13692006 | 3300010049 | Unclassified | 529 |
| 2 | Ga0123353_11815452 | 3300010167 | Bacteria | 757 |
| 3 | Ga0466717_057893 | 3300042604 | Unclassified | 1128 |
| 4 | Ga0466716_012336 | 3300042605 | Archaea | 1683 |
| 5 | Ga0466712_012216 | 3300042614 | Bacteria | 3207 |
| 6 | JGI24698J34947_10031384 | 3300002449 | Unclassified | 2797 |
| 7 | JGI24698J34947_10055226 | 3300002449 | Unclassified | 1980 |
| 8 | JGI24698J34947_10079396 | 3300002449 | Unclassified | 1545 |
| 9 | JGI24698J34947_10143415 | 3300002449 | Bacteria | 1003 |
| 10 | JGI24698J34947_10146947 | 3300002449 | Unclassified | 984 |
| 11 | JGI24702J35022_10013009 | 3300002462 | Bacteria | 4614 |
| 12 | Ga0123353_11393287 | 3300010167 | Unclassified | 902 |
| 13 | Ga0466719_415399 | 3300042606 | Bacteria | 2247 |
| 14 | Ga0466708_064893 | 3300042652 | Unclassified | 1171 |
| 15 | Ga0466712_033822 | 3300042614 | Bacteria | 5628 |
| 16 | Ga0466712_086587 | 3300042614 | Bacteria | 6046 |
| 17 | Ga0466712_162462 | 3300042614 | Unclassified | 4300 |
| 18 | JGI24698J34947_10080960 | 3300002449 | Unclassified | 1524 |
| 19 | JGI24698J34947_10086636 | 3300002449 | Unclassified | 1450 |
| 20 | JGI24698J34947_10144096 | 3300002449 | Unclassified | 999 |
| 21 | JGI24698J34947_10159804 | 3300002449 | Unclassified | 924 |
| 22 | JGI24698J34947_10297929 | 3300002449 | Unclassified | 582 |
| 23 | JGI24699J35502_10347964 | 3300002509 | Unclassified | 539 |
| 24 | Ga0072941_1007097 | 3300005201 | Bacteria | 2086 |
| 25 | Ga0123356_10119150 | 3300010049 | Bacteria | 2564 |
| 26 | Ga0123356_13073600 | 3300010049 | Archaea | 582 |
| 27 | Ga0123356_13316259 | 3300010049 | Bacteria | 560 |
| 28 | Ga0123353_10745900 | 3300010167 | Bacteria | 1364 |
| 29 | Ga0466690_130808 | 3300042590 | Bacteria | 4934 |
| 30 | Ga0466696_106425 | 3300042596 | Bacteria | 2020 |
| 31 | Ga0466719_146821 | 3300042606 | Bacteria | 1894 |
| 32 | Ga0466731_110035 | 3300042622 | Unclassified | 1131 |
| 33 | Ga0466709_396183 | 3300042648 | Unclassified | 1257 |
| 34 | Ga0466712_023524 | 3300042614 | Bacteria | 21459 |
| 35 | Ga0466712_121328 | 3300042614 | Unclassified | 1682 |
| 36 | AustNasuHG_c1007439 | 3300000089 | Bacteria | 3902 |
| 37 | JGI24698J34947_10041259 | 3300002449 | Unclassified | 2378 |
| 38 | JGI24698J34947_10113678 | 3300002449 | Unclassified | 1189 |
| 39 | JGI24698J34947_10265517 | 3300002449 | Unclassified | 634 |
| 40 | JGI24702J35022_10019276 | 3300002462 | Unclassified | 3710 |
| 41 | JGI24699J35502_10368566 | 3300002509 | Unclassified | 548 |
| 42 | Ga0072941_1028553 | 3300005201 | Bacteria | 10817 |
| 43 | Ga0123356_12669929 | 3300010049 | Bacteria | 625 |
| 44 | Ga0466699_099773 | 3300042597 | Bacteria | 3510 |
| 45 | Ga0466699_124245 | 3300042597 | Bacteria | 3898 |
| 46 | Ga0466716_038086 | 3300042605 | Bacteria | 8613 |
| 47 | Ga0466719_136467 | 3300042606 | Bacteria | 7757 |
| 48 | Ga0466731_015429 | 3300042622 | Bacteria | 1907 |
| 49 | Ga0466712_046964 | 3300042614 | Bacteria | 7721 |
| 50 | Ga0466712_135370 | 3300042614 | Bacteria | 1257 |
| 51 | JGI24698J34947_10063448 | 3300002449 | Bacteria | 1810 |
| 52 | JGI24702J35022_10716913 | 3300002462 | Unclassified | 622 |
| 53 | Ga0123353_10441238 | 3300010167 | Bacteria | 1920 |
| 54 | Ga0466690_079719 | 3300042590 | Unclassified | 2312 |
| 55 | Ga0466722_069451 | 3300042609 | Bacteria | 1256 |
| 56 | Ga0466698_201423 | 3300042610 | Unclassified | 1154 |
| 57 | Ga0466712_025660 | 3300042614 | Bacteria | 1463 |
| 58 | Ga0466712_135379 | 3300042614 | Bacteria | 4033 |
| 59 | Ga0466712_233131 | 3300042614 | Unclassified | 1072 |
| 60 | Ga0466712_237775 | 3300042614 | Unclassified | 2113 |
| 61 | Ga0466715_077900 | 3300042616 | Unclassified | 2387 |
| 62 | AustNasuHG_c1062875 | 3300000089 | Unclassified | 708 |
| 63 | AustNasuHG_c1064538 | 3300000089 | Bacteria | 690 |
| 64 | JGI24698J34947_10002227 | 3300002449 | Bacteria | 10387 |
| 65 | JGI24698J34947_10135609 | 3300002449 | Bacteria | 1045 |
| 66 | Ga0466705_173955 | 3300042612 | Bacteria | 20540 |
| 67 | Ga0466733_162991 | 3300042659 | Bacteria | 1251 |
| 68 | Ga0123353_10796948 | 3300010167 | Bacteria | 1305 |
| 69 | Ga0466690_203995 | 3300042590 | Unclassified | 1386 |
| 70 | Ga0466691_173109 | 3300042593 | Bacteria | 2797 |
| 71 | Ga0466694_409510 | 3300042594 | Bacteria | 2286 |
| 72 | Ga0466716_308397 | 3300042605 | Bacteria | 2277 |
| 73 | Ga0466698_256205 | 3300042610 | Unclassified | 1073 |
| 74 | Ga0466731_100425 | 3300042622 | Bacteria | 8116 |
| 75 | Ga0466702_352970 | 3300042635 | Bacteria | 2574 |
| 76 | Ga0466708_035146 | 3300042652 | Bacteria | 2971 |
| 77 | Ga0466708_201523 | 3300042652 | Unclassified | 2008 |
| 78 | Ga0466712_073211 | 3300042614 | Bacteria | 1431 |
| 79 | Ga0466712_126023 | 3300042614 | Bacteria | 10075 |
| 80 | Ga0466712_177193 | 3300042614 | Unclassified | 1409 |
| 81 | AustNasuHG_c1002105 | 3300000089 | Bacteria | 7190 |
| 82 | AustNasuHG_c1027289 | 3300000089 | Bacteria | 1749 |
| 83 | AustNasuHG_c1036702 | 3300000089 | Bacteria | 1266 |
| 84 | JGI24698J34947_10005994 | 3300002449 | Bacteria | 6672 |
| 85 | JGI24698J34947_10162835 | 3300002449 | Unclassified | 912 |
| 86 | JGI24698J34947_10235146 | 3300002449 | Unclassified | 694 |
| 87 | JGI24699J35502_11128875 | 3300002509 | Unclassified | 4531 |
| 88 | Ga0123356_10624395 | 3300010049 | Unclassified | 1243 |
| 89 | Ga0123353_10737865 | 3300010167 | Bacteria | 1373 |
| 90 | Ga0123353_10813823 | 3300010167 | Unclassified | 1287 |
| 91 | Ga0123353_11697740 | 3300010167 | Bacteria | 791 |
| 92 | Ga0123353_12803794 | 3300010167 | Unclassified | 571 |
| 93 | Ga0123354_10390634 | 3300010882 | Unclassified | 1190 |
| 94 | Ga0466690_125395 | 3300042590 | Bacteria | 2818 |
| 95 | Ga0466699_152290 | 3300042597 | Unclassified | 1322 |
| 96 | Ga0466701_023322 | 3300042598 | Bacteria | 1759 |
| 97 | Ga0466717_182322 | 3300042604 | Bacteria | 5255 |
| 98 | Ga0466716_131956 | 3300042605 | Bacteria | 7791 |
| 99 | Ga0466721_060938 | 3300042608 | Unclassified | 2059 |
| 100 | Ga0466698_030644 | 3300042610 | Bacteria | 1053 |
| 101 | Ga0466702_001992 | 3300042635 | Unclassified | 1242 |
| 102 | Ga0466712_001869 | 3300042614 | Bacteria | 11744 |
| 103 | Ga0466712_130102 | 3300042614 | Bacteria | 14039 |
| 104 | Ga0466718_161021 | 3300042617 | Unclassified | 1980 |
| 105 | JGI24698J34947_10017846 | 3300002449 | Unclassified | 3842 |
| 106 | JGI24698J34947_10039168 | 3300002449 | Unclassified | 2455 |
| 107 | JGI24698J34947_10160082 | 3300002449 | Unclassified | 923 |
| 108 | JGI24698J34947_10185037 | 3300002449 | Unclassified | 829 |
| 109 | Ga0072940_1205206 | 3300005200 | Bacteria | 566 |
| 110 | Ga0123353_10275937 | 3300010167 | Bacteria | 2586 |
| 111 | Ga0233288_1170119 | 3300022232 | Bacteria | 726 |
| 112 | Ga0466696_092175 | 3300042596 | Bacteria | 1421 |
| 113 | Ga0466696_444023 | 3300042596 | Unclassified | 1989 |
| 114 | Ga0466696_460741 | 3300042596 | Bacteria | 15140 |
| 115 | Ga0466699_254809 | 3300042597 | Bacteria | 1643 |
| 116 | Ga0466716_167997 | 3300042605 | Unclassified | 3177 |
| 117 | Ga0466734_058674 | 3300042623 | Unclassified | 1414 |
| 118 | Ga0466708_185228 | 3300042652 | Bacteria | 10032 |
| 119 | Ga0466712_068583 | 3300042614 | Bacteria | 1343 |
| 120 | Ga0466712_158877 | 3300042614 | Bacteria | 28725 |
| 121 | Ga0466715_328614 | 3300042616 | Bacteria | 6640 |
| 122 | JGI24698J34947_10101282 | 3300002449 | Bacteria | 1294 |
| 123 | JGI24698J34947_10355225 | 3300002449 | Unclassified | 512 |
| 124 | JGI24697J35500_11179817 | 3300002507 | Unclassified | 1509 |
| 125 | Ga0072941_1005418 | 3300005201 | Bacteria | 38572 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.