Protein Family IF07251
Metagenome
Isolate
149
Members
46
Samples
142
Scaffolds
370.58
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_496138|Ga0466705_496138_3994_5244
- Length
- 416 aa
- Sequence
- LKNVTLGNAEYSNLFFSCSDFKLFIWIHGTLLDARNFAGGAALGNYESRVRGMKLSLIIPCYNEERTIEDCVSRVLGIAKGRDFSIEAVVVDDASTDRSLSVLEKIAKEHEEVTVLRHERNRGKGAALRTGLMRATGDFVGIQDADAEYDPAEYVDMLEPLLDGRADVVYGSRYLRPDTRRVLYFWHTWMNKALTFVSNMFTNLDITDMETCYKLFRGDVIRSIAPTLREERFGFEPEITAKVAQERCRVYECAISYNPRTYEEGKKIGWKDGFHALYCILHYSAPTAPLPMQILIYFFIGFLSLLLNLSIFSLTFPLTGTTLSIVGSFMIAAVFNYLLCVSLLFRHKARWDTFGEAALYVVSVALMGLVDYGVTLGLMALSWSPGYSKFWAAVTGFVGNFIVRKYLVFPEKKRVR
Sample Types
Isolate
4.7%
Metagenome
95.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.9%
Kalotermitidae
25.0%
Unclassified
22.7%
Termopsidae
6.8%
Rhinotermitidae
4.5%
Taxonomy
Archaea
0
Bacteria
135
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2778260940 | Unclassified Fibrobacteres Mp193P3bin36 | Isolate | Unclassified |
| 2 | 2778260941 | Unclassified Fibrobacteres Th196P3bin8 | Isolate | Unclassified |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 5 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 6 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 7 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 8 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 16 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 17 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 18 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 2778260937 | Unclassified Fibrobacteres Co191P3bin40 | Isolate | Unclassified |
| 26 | 2820716747 | Unclassified Fibrobacteres Nc150P3bin18 | Isolate | Unclassified |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 29 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 33 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 34 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 35 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 36 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 37 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 38 | 2778260939 | Unclassified Fibrobacteres Co191P4bin13 | Isolate | Unclassified |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 41 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 42 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 43 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 44 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 45 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 46 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_371557 | 3300042612 | Bacteria | 2021 |
| 2 | Ga0123356_10037823 | 3300010049 | Bacteria | 4500 |
| 3 | AustNasuHG_c1015109 | 3300000089 | Unclassified | 2611 |
| 4 | JGI24698J34947_10018139 | 3300002449 | Bacteria | 3808 |
| 5 | JGI24695J34938_10005268 | 3300002450 | Bacteria | 8145 |
| 6 | Ga0072941_1003790 | 3300005201 | Bacteria | 20719 |
| 7 | Ga0072941_1023644 | 3300005201 | Bacteria | 4916 |
| 8 | Ga0264413_113368 | 3300024493 | Bacteria | 14498 |
| 9 | Ga0466692_192613 | 3300042591 | Bacteria | 2810 |
| 10 | Ga0466694_065026 | 3300042594 | Bacteria | 24875 |
| 11 | Ga0466696_268085 | 3300042596 | Bacteria | 4298 |
| 12 | Ga0466699_382868 | 3300042597 | Bacteria | 1902 |
| 13 | Ga0466719_195905 | 3300042606 | Bacteria | 7284 |
| 14 | Ga0466712_217249 | 3300042614 | Bacteria | 27211 |
| 15 | Ga0466711_260628 | 3300042615 | Bacteria | 11863 |
| 16 | Ga0466718_044196 | 3300042617 | Bacteria | 15851 |
| 17 | Ga0466718_061196 | 3300042617 | Bacteria | 25905 |
| 18 | Ga0466704_130684 | 3300042643 | Bacteria | 12057 |
| 19 | Ga0466727_255020 | 3300042655 | Bacteria | 1727 |
| 20 | Ga0466732_000710 | 3300042656 | Bacteria | 21752 |
| 21 | AustNasuHG_c1011546 | 3300000089 | Bacteria | 3061 |
| 22 | JGI24698J34947_10024871 | 3300002449 | Bacteria | 3192 |
| 23 | JGI24698J34947_10043723 | 3300002449 | Unclassified | 2295 |
| 24 | Ga0264413_112037 | 3300024493 | Bacteria | 36190 |
| 25 | Ga0264413_112497 | 3300024493 | Bacteria | 22746 |
| 26 | Ga0466713_105184 | 3300042602 | Unclassified | 6933 |
| 27 | Ga0466722_232757 | 3300042609 | Bacteria | 3778 |
| 28 | Ga0466705_496138 | 3300042612 | Bacteria | 5626 |
| 29 | Ga0466712_025014 | 3300042614 | Bacteria | 1782 |
| 30 | Ga0466712_089947 | 3300042614 | Unclassified | 11406 |
| 31 | Ga0466711_116183 | 3300042615 | Bacteria | 21585 |
| 32 | Ga0466718_129007 | 3300042617 | Bacteria | 23764 |
| 33 | Ga0466708_280760 | 3300042652 | Bacteria | 81850 |
| 34 | Ga0466732_181065 | 3300042656 | Bacteria | 4825 |
| 35 | Ga0466699_249018 | 3300042597 | Bacteria | 2944 |
| 36 | Ga0466707_058149 | 3300042601 | Bacteria | 1942 |
| 37 | Ga0466713_017199 | 3300042602 | Bacteria | 4606 |
| 38 | Ga0466713_120859 | 3300042602 | Bacteria | 2399 |
| 39 | Ga0466711_339224 | 3300042615 | Bacteria | 1875 |
| 40 | Ga0466718_118076 | 3300042617 | Bacteria | 20033 |
| 41 | Ga0466726_235932 | 3300042619 | Bacteria | 6201 |
| 42 | Ga0466726_282115 | 3300042619 | Unclassified | 1854 |
| 43 | Ga0466735_055244 | 3300042624 | Bacteria | 3378 |
| 44 | Ga0466704_119528 | 3300042643 | Bacteria | 1792 |
| 45 | Ga0466705_205589 | 3300042612 | Bacteria | 5021 |
| 46 | AustNasuHG_c1000273 | 3300000089 | Bacteria | 17705 |
| 47 | JGI24695J34938_10003112 | 3300002450 | Bacteria | 11842 |
| 48 | Ga0072941_1077104 | 3300005201 | Bacteria | 7008 |
| 49 | Ga0264413_104201 | 3300024493 | Bacteria | 22073 |
| 50 | Ga0415639_055092 | 3300038395 | Bacteria | 3901 |
| 51 | Ga0466694_004667 | 3300042594 | Bacteria | 11434 |
| 52 | Ga0466707_292198 | 3300042601 | Bacteria | 1707 |
| 53 | Ga0466716_508803 | 3300042605 | Bacteria | 1400 |
| 54 | Ga0466720_030897 | 3300042607 | Bacteria | 17817 |
| 55 | Ga0466722_118904 | 3300042609 | Bacteria | 1233 |
| 56 | Ga0466711_422813 | 3300042615 | Bacteria | 2481 |
| 57 | Ga0466726_360339 | 3300042619 | Bacteria | 5122 |
| 58 | Ga0466704_550429 | 3300042643 | Bacteria | 2021 |
| 59 | Ga0466708_206730 | 3300042652 | Unclassified | 6428 |
| 60 | AustNasuHG_c1004940 | 3300000089 | Bacteria | 4772 |
| 61 | AustNasuHG_c1007290 | 3300000089 | Bacteria | 3938 |
| 62 | AustNasuHG_c1017162 | 3300000089 | Bacteria | 2411 |
| 63 | JGI24698J34947_10015812 | 3300002449 | Bacteria | 4104 |
| 64 | JGI24695J34938_10001406 | 3300002450 | Bacteria | 20562 |
| 65 | Ga0068305_10044636 | 3300005083 | Bacteria | 5020 |
| 66 | Ga0072941_1013742 | 3300005201 | Bacteria | 14140 |
| 67 | Ga0264413_122825 | 3300024493 | Bacteria | 13982 |
| 68 | Ga0466694_115165 | 3300042594 | Bacteria | 3845 |
| 69 | Ga0466720_057161 | 3300042607 | Bacteria | 10519 |
| 70 | Ga0466722_173329 | 3300042609 | Bacteria | 4072 |
| 71 | Ga0466712_180254 | 3300042614 | Unclassified | 5498 |
| 72 | Ga0466711_225804 | 3300042615 | Unclassified | 1751 |
| 73 | Ga0466715_157238 | 3300042616 | Bacteria | 4104 |
| 74 | Ga0466715_216059 | 3300042616 | Bacteria | 7668 |
| 75 | Ga0466718_027823 | 3300042617 | Bacteria | 12126 |
| 76 | Ga0466726_067353 | 3300042619 | Bacteria | 5057 |
| 77 | Ga0466703_239917 | 3300042636 | Bacteria | 2932 |
| 78 | Ga0466704_590883 | 3300042643 | Bacteria | 6512 |
| 79 | Ga0466727_224459 | 3300042655 | Bacteria | 1474 |
| 80 | AustNasuHG_c1030815 | 3300000089 | Bacteria | 1532 |
| 81 | JGI24698J34947_10013395 | 3300002449 | Bacteria | 4478 |
| 82 | JGI24698J34947_10036959 | 3300002449 | Unclassified | 2540 |
| 83 | Ga0068305_10154065 | 3300005083 | Bacteria | 5926 |
| 84 | Ga0072941_1004046 | 3300005201 | Bacteria | 45352 |
| 85 | Ga0072941_1009759 | 3300005201 | Bacteria | 77968 |
| 86 | Ga0264413_109210 | 3300024493 | Bacteria | 4673 |
| 87 | Ga0264413_113760 | 3300024493 | Bacteria | 8890 |
| 88 | Ga0466694_407010 | 3300042594 | Bacteria | 2571 |
| 89 | Ga0466699_008070 | 3300042597 | Bacteria | 23608 |
| 90 | Ga0466699_063131 | 3300042597 | Bacteria | 2836 |
| 91 | Ga0466700_073820 | 3300042600 | Bacteria | 93486 |
| 92 | Ga0466719_206789 | 3300042606 | Bacteria | 9370 |
| 93 | Ga0466721_272980 | 3300042608 | Bacteria | 1775 |
| 94 | Ga0466712_020317 | 3300042614 | Bacteria | 13424 |
| 95 | Ga0466712_157001 | 3300042614 | Bacteria | 4199 |
| 96 | Ga0466711_142820 | 3300042615 | Bacteria | 35097 |
| 97 | Ga0466711_170527 | 3300042615 | Bacteria | 7921 |
| 98 | Ga0466711_425000 | 3300042615 | Unclassified | 2919 |
| 99 | Ga0466715_547093 | 3300042616 | Bacteria | 7487 |
| 100 | Ga0466726_229267 | 3300042619 | Bacteria | 12683 |
| 101 | Ga0466702_043906 | 3300042635 | Bacteria | 4131 |
| 102 | Ga0466702_118763 | 3300042635 | Bacteria | 2829 |
| 103 | Ga0466702_300364 | 3300042635 | Bacteria | 2948 |
| 104 | Ga0466709_168357 | 3300042648 | Bacteria | 5413 |
| 105 | Ga0466725_389559 | 3300042654 | Bacteria | 1706 |
| 106 | JGI24698J34947_10001174 | 3300002449 | Bacteria | 13653 |
| 107 | Ga0072940_1172388 | 3300005200 | Bacteria | 2840 |
| 108 | Ga0072941_1012172 | 3300005201 | Bacteria | 11972 |
| 109 | Ga0264413_116607 | 3300024493 | Unclassified | 10601 |
| 110 | Ga0466692_120707 | 3300042591 | Bacteria | 8648 |
| 111 | Ga0466694_268653 | 3300042594 | Bacteria | 2620 |
| 112 | Ga0466696_298520 | 3300042596 | Bacteria | 7147 |
| 113 | Ga0466717_189644 | 3300042604 | Bacteria | 2451 |
| 114 | Ga0466719_401254 | 3300042606 | Bacteria | 2177 |
| 115 | Ga0466712_223181 | 3300042614 | Bacteria | 12732 |
| 116 | Ga0466711_447405 | 3300042615 | Bacteria | 11641 |
| 117 | Ga0466715_036183 | 3300042616 | Bacteria | 2424 |
| 118 | Ga0466715_144891 | 3300042616 | Bacteria | 8735 |
| 119 | Ga0466715_328069 | 3300042616 | Bacteria | 3994 |
| 120 | Ga0466718_075768 | 3300042617 | Bacteria | 28444 |
| 121 | Ga0466723_107106 | 3300042618 | Bacteria | 15083 |
| 122 | Ga0466703_103119 | 3300042636 | Bacteria | 4060 |
| 123 | Ga0466704_127837 | 3300042643 | Bacteria | 6059 |
| 124 | Ga0466705_129858 | 3300042612 | Unclassified | 4915 |
| 125 | Ga0466732_234248 | 3300042656 | Bacteria | 1487 |
| 126 | JGI24698J34947_10015901 | 3300002449 | Bacteria | 4091 |
| 127 | JGI24696J40584_12961263 | 3300002834 | Unclassified | 12783 |
| 128 | Ga0072940_1019143 | 3300005200 | Bacteria | 4838 |
| 129 | Ga0072941_1013741 | 3300005201 | Bacteria | 21395 |
| 130 | Ga0072941_1110436 | 3300005201 | Bacteria | 3997 |
| 131 | Ga0264413_110785 | 3300024493 | Bacteria | 16824 |
| 132 | Ga0264413_124563 | 3300024493 | Unclassified | 6050 |
| 133 | Ga0466707_372628 | 3300042601 | Bacteria | 2182 |
| 134 | Ga0466719_234595 | 3300042606 | Bacteria | 2252 |
| 135 | Ga0466720_045967 | 3300042607 | Bacteria | 61775 |
| 136 | Ga0466720_071927 | 3300042607 | Bacteria | 79746 |
| 137 | Ga0466712_021178 | 3300042614 | Bacteria | 5639 |
| 138 | Ga0466712_038227 | 3300042614 | Bacteria | 14314 |
| 139 | Ga0466726_246579 | 3300042619 | Bacteria | 3939 |
| 140 | Ga0466704_285321 | 3300042643 | Bacteria | 12799 |
| 141 | Ga0466704_450884 | 3300042643 | Bacteria | 7566 |
| 142 | Ga0466708_362367 | 3300042652 | Bacteria | 4357 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.