Protein Family IF07222
Metagenome
Isolate
111
Members
38
Samples
105
Scaffolds
522.06
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_414425|Ga0466705_414425_2438_4006
- Length
- 508 aa
- Sequence
- MFLLFALALPLFAGQTGPTAIELWYGPAVTEAGPPPADWKALQLIRDRVNVNLTLSALPSNEGDQDVKINAAAAANNLPDLFMVRRPVLMNIIKVGLIAPVDSLYPLMPNRTKQHYDADATGYTTFNGQSYGLATPGAIIKNEGLLIRKDWLDNLGLKVPTTTDELFEVMRAFTTRDPDGNGRADTYGYGAFLEITPPWEEGLGRRLDPIFGAFGVAGTFNLTKAGAGLNIKKPAYFEALTYIKRMVDEKVIDPNWTSYGKDDFRAAWKQGRFGIMREQNAAFAAESNYAPFDKNFPKGEWLLIDPPKGPRGEQSVGVYTASYRIYAVSKKALDAGKGPAIARLLEWMSSDEGYFLLAFGEKGVNYLPDANGVPTVEGLPDPSRGYTRPEMQPLTQLRNMVYYNSEVELLARYPTYQAPTSGRTMSALTVLFDMQKRAWTPNIGSDTLPNPNADLKRFYEQGVIEFALGQRQLTQANWNAWVQEFGRMGGDQWEKDCLEAAEASGYIK
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
40.5%
Termitidae
35.1%
Unclassified
10.8%
Termopsidae
5.4%
Rhinotermitidae
5.4%
Blaberidae
2.7%
Taxonomy
Archaea
0
Bacteria
106
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 3 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 4 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 5 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 6 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 7 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 8 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 9 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 12 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 15 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 16 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 17 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 18 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 25 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_001436 | 3300042612 | Bacteria | 17855 |
| 2 | Ga0466705_086011 | 3300042612 | Bacteria | 10166 |
| 3 | Ga0466705_112086 | 3300042612 | Bacteria | 12461 |
| 4 | Ga0466722_189076 | 3300042609 | Bacteria | 2861 |
| 5 | Ga0466705_414425 | 3300042612 | Bacteria | 11317 |
| 6 | Ga0415639_010394 | 3300038395 | Bacteria | 11605 |
| 7 | Ga0466690_214071 | 3300042590 | Bacteria | 16418 |
| 8 | Ga0466692_066278 | 3300042591 | Bacteria | 3508 |
| 9 | Ga0466692_143855 | 3300042591 | Bacteria | 4958 |
| 10 | Ga0466733_111851 | 3300042659 | Bacteria | 82439 |
| 11 | Ga0466713_063109 | 3300042602 | Bacteria | 3833 |
| 12 | Ga0466720_081487 | 3300042607 | Bacteria | 31706 |
| 13 | Ga0466704_042627 | 3300042643 | Unclassified | 6284 |
| 14 | Ga0466709_179084 | 3300042648 | Bacteria | 4387 |
| 15 | Ga0466708_147328 | 3300042652 | Bacteria | 8131 |
| 16 | Ga0466711_032414 | 3300042615 | Bacteria | 20943 |
| 17 | Ga0466718_116758 | 3300042617 | Bacteria | 14641 |
| 18 | Ga0123354_10018989 | 3300010882 | Bacteria | 10795 |
| 19 | JGI24698J34947_10012555 | 3300002449 | Bacteria | 4642 |
| 20 | Ga0466705_201292 | 3300042612 | Bacteria | 5199 |
| 21 | Ga0466732_118680 | 3300042656 | Bacteria | 9111 |
| 22 | Ga0466722_051815 | 3300042609 | Bacteria | 15391 |
| 23 | Ga0466704_302047 | 3300042643 | Unclassified | 4006 |
| 24 | Ga0466711_126039 | 3300042615 | Bacteria | 5250 |
| 25 | Ga0466711_422352 | 3300042615 | Bacteria | 2434 |
| 26 | Ga0466728_418472 | 3300042620 | Bacteria | 9456 |
| 27 | Ga0466690_124516 | 3300042590 | Bacteria | 9683 |
| 28 | Ga0466691_127732 | 3300042593 | Bacteria | 11614 |
| 29 | Ga0466694_244312 | 3300042594 | Bacteria | 37974 |
| 30 | Ga0072941_1048408 | 3300005201 | Bacteria | 3468 |
| 31 | Ga0466705_126222 | 3300042612 | Bacteria | 8501 |
| 32 | Ga0466705_321928 | 3300042612 | Bacteria | 28342 |
| 33 | Ga0466731_350908 | 3300042622 | Bacteria | 3084 |
| 34 | Ga0466704_033321 | 3300042643 | Bacteria | 22698 |
| 35 | Ga0466709_216249 | 3300042648 | Bacteria | 16336 |
| 36 | Ga0466711_325890 | 3300042615 | Bacteria | 8844 |
| 37 | Ga0466726_287535 | 3300042619 | Bacteria | 15444 |
| 38 | Ga0466690_012256 | 3300042590 | Bacteria | 3296 |
| 39 | Ga0466691_079092 | 3300042593 | Bacteria | 17061 |
| 40 | Ga0072941_1059593 | 3300005201 | Bacteria | 24866 |
| 41 | Ga0072941_1141946 | 3300005201 | Bacteria | 3052 |
| 42 | Ga0466722_175899 | 3300042609 | Bacteria | 3869 |
| 43 | Ga0466722_197142 | 3300042609 | Bacteria | 8548 |
| 44 | Ga0466703_155900 | 3300042636 | Bacteria | 4539 |
| 45 | Ga0466704_171804 | 3300042643 | Bacteria | 7129 |
| 46 | Ga0466704_479716 | 3300042643 | Bacteria | 8080 |
| 47 | Ga0466708_330003 | 3300042652 | Bacteria | 2671 |
| 48 | Ga0466727_168863 | 3300042655 | Bacteria | 13700 |
| 49 | Ga0466712_178547 | 3300042614 | Bacteria | 12495 |
| 50 | Ga0466715_238123 | 3300042616 | Bacteria | 9038 |
| 51 | Ga0466723_013566 | 3300042618 | Bacteria | 7029 |
| 52 | Ga0466723_168978 | 3300042618 | Bacteria | 11427 |
| 53 | Ga0466728_244014 | 3300042620 | Bacteria | 12713 |
| 54 | Ga0466690_073261 | 3300042590 | Bacteria | 5050 |
| 55 | Ga0466696_307974 | 3300042596 | Bacteria | 34055 |
| 56 | Ga0123356_10021945 | 3300010049 | Bacteria | 6029 |
| 57 | Ga0466733_208167 | 3300042659 | Bacteria | 31218 |
| 58 | Ga0466719_121316 | 3300042606 | Unclassified | 3043 |
| 59 | Ga0466704_095845 | 3300042643 | Bacteria | 89284 |
| 60 | Ga0466709_178541 | 3300042648 | Bacteria | 10415 |
| 61 | Ga0466708_038980 | 3300042652 | Bacteria | 16274 |
| 62 | Ga0466727_030848 | 3300042655 | Bacteria | 2698 |
| 63 | Ga0466718_016240 | 3300042617 | Bacteria | 3701 |
| 64 | Ga0466723_293823 | 3300042618 | Bacteria | 10602 |
| 65 | Ga0466696_154301 | 3300042596 | Bacteria | 2829 |
| 66 | Ga0466699_005997 | 3300042597 | Bacteria | 4766 |
| 67 | Ga0466699_203058 | 3300042597 | Bacteria | 2531 |
| 68 | Ga0123356_10010623 | 3300010049 | Bacteria | 9021 |
| 69 | Ga0466707_045710 | 3300042601 | Bacteria | 10942 |
| 70 | Ga0466716_179575 | 3300042605 | Bacteria | 8078 |
| 71 | Ga0466720_084737 | 3300042607 | Bacteria | 18029 |
| 72 | Ga0466722_157764 | 3300042609 | Bacteria | 7540 |
| 73 | Ga0466703_152308 | 3300042636 | Bacteria | 7410 |
| 74 | Ga0466703_191810 | 3300042636 | Bacteria | 6920 |
| 75 | Ga0466704_119498 | 3300042643 | Bacteria | 6175 |
| 76 | Ga0466704_295827 | 3300042643 | Unclassified | 5131 |
| 77 | Ga0466709_018963 | 3300042648 | Bacteria | 10441 |
| 78 | Ga0466708_145218 | 3300042652 | Bacteria | 21009 |
| 79 | Ga0466723_120222 | 3300042618 | Bacteria | 4260 |
| 80 | Ga0466726_097959 | 3300042619 | Bacteria | 16779 |
| 81 | Ga0466690_021839 | 3300042590 | Bacteria | 3785 |
| 82 | Ga0466692_096783 | 3300042591 | Bacteria | 19299 |
| 83 | Ga0466691_043739 | 3300042593 | Bacteria | 24323 |
| 84 | Ga0123356_10102484 | 3300010049 | Bacteria | 2748 |
| 85 | Ga0072941_1021846 | 3300005201 | Bacteria | 9925 |
| 86 | Ga0466705_222187 | 3300042612 | Bacteria | 16736 |
| 87 | Ga0466713_075485 | 3300042602 | Bacteria | 3716 |
| 88 | Ga0466716_238710 | 3300042605 | Bacteria | 8964 |
| 89 | Ga0466716_335733 | 3300042605 | Bacteria | 3377 |
| 90 | Ga0466719_561168 | 3300042606 | Bacteria | 2432 |
| 91 | Ga0466720_018543 | 3300042607 | Bacteria | 131979 |
| 92 | Ga0466722_063621 | 3300042609 | Bacteria | 6435 |
| 93 | Ga0466722_166522 | 3300042609 | Bacteria | 7319 |
| 94 | Ga0466704_263674 | 3300042643 | Bacteria | 3889 |
| 95 | Ga0466704_387584 | 3300042643 | Bacteria | 5497 |
| 96 | Ga0466704_480542 | 3300042643 | Bacteria | 2091 |
| 97 | Ga0466708_177031 | 3300042652 | Bacteria | 25545 |
| 98 | Ga0466715_460929 | 3300042616 | Bacteria | 18133 |
| 99 | Ga0466718_097298 | 3300042617 | Bacteria | 24857 |
| 100 | Ga0466718_168964 | 3300042617 | Bacteria | 6403 |
| 101 | Ga0466723_099606 | 3300042618 | Bacteria | 3290 |
| 102 | Ga0466690_186795 | 3300042590 | Unclassified | 2930 |
| 103 | Ga0466690_390620 | 3300042590 | Bacteria | 26148 |
| 104 | Ga0466696_090401 | 3300042596 | Bacteria | 10101 |
| 105 | AustNasuHG_c1001273 | 3300000089 | Bacteria | 9064 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13416 | SBP_bac_8 | Bacterial extracellular solute-binding protein | 52 | 353 | 0.69 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.