Protein Family IF07181
Metagenome
Isolate
130
Members
28
Samples
127
Scaffolds
185.92
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_298517|Ga0466705_298517_457_1128
- Length
- 223 aa
- Sequence
- MKERHIPPGSPAAGAEAEYGKAFGFFVIKSHTFCLKEKPMKKFSVVLICILAALAMGCGGAPDTRVNDPNVPEWLNDFPPEDVLWGIGSAKQSTDNMSMTMAEARARQNIANQLSVEVQGMITDYARDAGTINNQTSLALAESVSRQVTDATLTGVTPIKRWKAPNDTWWYLLQLSKTDAARTASDIIDSEAARYSEFKSMEALKLMDVQLAKKNDKPVPVTE
Sample Types
Isolate
2.3%
Metagenome
97.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
50.0%
Termitidae
17.9%
Unclassified
14.3%
Termopsidae
10.7%
Rhinotermitidae
7.1%
Taxonomy
Archaea
0
Bacteria
119
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 2 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 5 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 6 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 7 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 8 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 9 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 10 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 11 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 12 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 13 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 14 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 15 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 16 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 24 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 25 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 26 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_228273 | 3300042601 | Unclassified | 1614 |
| 2 | Ga0466707_409985 | 3300042601 | Bacteria | 1250 |
| 3 | Ga0466719_355862 | 3300042606 | Bacteria | 2380 |
| 4 | Ga0466720_129233 | 3300042607 | Bacteria | 1836 |
| 5 | Ga0466690_063219 | 3300042590 | Bacteria | 1107 |
| 6 | Ga0466690_097860 | 3300042590 | Bacteria | 2538 |
| 7 | Ga0466690_320658 | 3300042590 | Bacteria | 2062 |
| 8 | Ga0466691_031314 | 3300042593 | Bacteria | 2602 |
| 9 | Ga0466691_038891 | 3300042593 | Bacteria | 11207 |
| 10 | Ga0466691_060410 | 3300042593 | Bacteria | 3724 |
| 11 | Ga0466691_195886 | 3300042593 | Bacteria | 9290 |
| 12 | Ga0466694_200627 | 3300042594 | Unclassified | 3678 |
| 13 | Ga0466705_298517 | 3300042612 | Bacteria | 3023 |
| 14 | Ga0466705_520689 | 3300042612 | Bacteria | 2924 |
| 15 | Ga0466715_534778 | 3300042616 | Bacteria | 25308 |
| 16 | Ga0466726_173799 | 3300042619 | Unclassified | 1492 |
| 17 | Ga0466704_574270 | 3300042643 | Bacteria | 2849 |
| 18 | Ga0466708_300719 | 3300042652 | Bacteria | 1255 |
| 19 | Ga0466708_366533 | 3300042652 | Bacteria | 4608 |
| 20 | Ga0466719_076946 | 3300042606 | Bacteria | 2345 |
| 21 | Ga0466719_233641 | 3300042606 | Bacteria | 1670 |
| 22 | Ga0466722_198443 | 3300042609 | Bacteria | 2571 |
| 23 | Ga0466692_074346 | 3300042591 | Bacteria | 18199 |
| 24 | Ga0466692_151134 | 3300042591 | Bacteria | 11495 |
| 25 | Ga0466691_171101 | 3300042593 | Bacteria | 1247 |
| 26 | Ga0123354_10153498 | 3300010882 | Unclassified | 2776 |
| 27 | JGI24695J34938_10072805 | 3300002450 | Bacteria | 1432 |
| 28 | Ga0466705_013695 | 3300042612 | Bacteria | 9197 |
| 29 | Ga0466705_312133 | 3300042612 | Bacteria | 5007 |
| 30 | Ga0466715_298784 | 3300042616 | Bacteria | 10278 |
| 31 | Ga0466704_128283 | 3300042643 | Unclassified | 7416 |
| 32 | Ga0466704_171502 | 3300042643 | Bacteria | 4785 |
| 33 | Ga0466704_203087 | 3300042643 | Bacteria | 8736 |
| 34 | Ga0466719_331845 | 3300042606 | Bacteria | 3712 |
| 35 | Ga0466722_195616 | 3300042609 | Unclassified | 1059 |
| 36 | Ga0466691_095760 | 3300042593 | Bacteria | 2618 |
| 37 | Ga0466691_102693 | 3300042593 | Bacteria | 6107 |
| 38 | Ga0466691_117733 | 3300042593 | Bacteria | 3681 |
| 39 | Ga0466711_139849 | 3300042615 | Bacteria | 4300 |
| 40 | Ga0466711_147391 | 3300042615 | Bacteria | 2447 |
| 41 | Ga0466711_366651 | 3300042615 | Bacteria | 1849 |
| 42 | Ga0466711_478940 | 3300042615 | Bacteria | 1097 |
| 43 | Ga0466715_170857 | 3300042616 | Bacteria | 4123 |
| 44 | Ga0466723_273802 | 3300042618 | Bacteria | 3278 |
| 45 | Ga0466735_069833 | 3300042624 | Bacteria | 1301 |
| 46 | Ga0466703_187572 | 3300042636 | Bacteria | 1039 |
| 47 | Ga0466704_101079 | 3300042643 | Bacteria | 2498 |
| 48 | Ga0466704_367015 | 3300042643 | Bacteria | 11571 |
| 49 | Ga0466708_102504 | 3300042652 | Bacteria | 3981 |
| 50 | Ga0466719_004120 | 3300042606 | Bacteria | 2820 |
| 51 | Ga0466696_135077 | 3300042596 | Bacteria | 9054 |
| 52 | Ga0466715_602010 | 3300042616 | Bacteria | 5778 |
| 53 | Ga0466728_230444 | 3300042620 | Bacteria | 5595 |
| 54 | Ga0466728_391124 | 3300042620 | Bacteria | 2446 |
| 55 | Ga0466735_032855 | 3300042624 | Bacteria | 2803 |
| 56 | Ga0466735_137545 | 3300042624 | Bacteria | 26472 |
| 57 | Ga0466703_177637 | 3300042636 | Bacteria | 197398 |
| 58 | Ga0466704_132124 | 3300042643 | Bacteria | 11847 |
| 59 | Ga0466709_111208 | 3300042648 | Bacteria | 1647 |
| 60 | Ga0466708_349026 | 3300042652 | Bacteria | 4677 |
| 61 | Ga0466719_452642 | 3300042606 | Bacteria | 1169 |
| 62 | Ga0466690_114803 | 3300042590 | Bacteria | 9369 |
| 63 | Ga0466696_250137 | 3300042596 | Bacteria | 6953 |
| 64 | Ga0123357_10010057 | 3300009784 | Bacteria | 11998 |
| 65 | Ga0466705_132096 | 3300042612 | Bacteria | 7289 |
| 66 | Ga0466705_191860 | 3300042612 | Bacteria | 2933 |
| 67 | Ga0466711_365119 | 3300042615 | Bacteria | 2438 |
| 68 | Ga0466723_223856 | 3300042618 | Bacteria | 6163 |
| 69 | Ga0466703_350077 | 3300042636 | Bacteria | 2794 |
| 70 | Ga0466709_206916 | 3300042648 | Bacteria | 2662 |
| 71 | Ga0466709_391390 | 3300042648 | Bacteria | 2509 |
| 72 | Ga0466708_227773 | 3300042652 | Bacteria | 5814 |
| 73 | Ga0466722_076982 | 3300042609 | Bacteria | 6244 |
| 74 | Ga0466691_048870 | 3300042593 | Bacteria | 1239 |
| 75 | Ga0466696_229096 | 3300042596 | Bacteria | 5423 |
| 76 | Ga0466705_029684 | 3300042612 | Bacteria | 3882 |
| 77 | Ga0466705_167596 | 3300042612 | Bacteria | 4404 |
| 78 | Ga0466705_500244 | 3300042612 | Unclassified | 2506 |
| 79 | Ga0466715_019433 | 3300042616 | Bacteria | 2377 |
| 80 | Ga0466715_594489 | 3300042616 | Bacteria | 2210 |
| 81 | Ga0466715_621118 | 3300042616 | Bacteria | 1713 |
| 82 | Ga0466723_061057 | 3300042618 | Bacteria | 6733 |
| 83 | Ga0466728_065708 | 3300042620 | Bacteria | 1606 |
| 84 | Ga0466728_243089 | 3300042620 | Bacteria | 5351 |
| 85 | Ga0466703_004988 | 3300042636 | Bacteria | 2735 |
| 86 | Ga0466703_171463 | 3300042636 | Bacteria | 4222 |
| 87 | Ga0466708_159755 | 3300042652 | Bacteria | 1312 |
| 88 | Ga0466707_244977 | 3300042601 | Unclassified | 1216 |
| 89 | Ga0466716_126491 | 3300042605 | Bacteria | 1107 |
| 90 | Ga0466716_456328 | 3300042605 | Bacteria | 1560 |
| 91 | Ga0466722_106807 | 3300042609 | Bacteria | 3377 |
| 92 | Ga0466690_072115 | 3300042590 | Bacteria | 1043 |
| 93 | Ga0466690_072570 | 3300042590 | Bacteria | 1070 |
| 94 | Ga0466696_495887 | 3300042596 | Bacteria | 4555 |
| 95 | Ga0123357_10018920 | 3300009784 | Bacteria | 9164 |
| 96 | Ga0466705_117858 | 3300042612 | Unclassified | 3148 |
| 97 | Ga0466705_359271 | 3300042612 | Unclassified | 4348 |
| 98 | Ga0466715_087961 | 3300042616 | Bacteria | 17232 |
| 99 | Ga0466715_198042 | 3300042616 | Bacteria | 1528 |
| 100 | Ga0466728_285908 | 3300042620 | Bacteria | 1973 |
| 101 | Ga0466728_404711 | 3300042620 | Bacteria | 4030 |
| 102 | Ga0466704_095946 | 3300042643 | Bacteria | 6133 |
| 103 | Ga0466704_273945 | 3300042643 | Bacteria | 8740 |
| 104 | Ga0466709_266173 | 3300042648 | Bacteria | 20582 |
| 105 | Ga0466708_075874 | 3300042652 | Bacteria | 7112 |
| 106 | Ga0466708_140981 | 3300042652 | Bacteria | 6998 |
| 107 | Ga0466727_060810 | 3300042655 | Bacteria | 1259 |
| 108 | Ga0466707_349127 | 3300042601 | Bacteria | 1113 |
| 109 | Ga0466716_422469 | 3300042605 | Bacteria | 2386 |
| 110 | Ga0466719_065865 | 3300042606 | Bacteria | 1279 |
| 111 | Ga0466719_226210 | 3300042606 | Bacteria | 1358 |
| 112 | Ga0466722_090264 | 3300042609 | Bacteria | 1293 |
| 113 | Ga0466690_201111 | 3300042590 | Bacteria | 1914 |
| 114 | Ga0466696_031985 | 3300042596 | Bacteria | 4315 |
| 115 | Ga0466696_108985 | 3300042596 | Bacteria | 3560 |
| 116 | Ga0466705_059836 | 3300042612 | Bacteria | 5247 |
| 117 | Ga0466715_549375 | 3300042616 | Bacteria | 1630 |
| 118 | Ga0466723_270176 | 3300042618 | Bacteria | 12416 |
| 119 | Ga0466728_315850 | 3300042620 | Bacteria | 5585 |
| 120 | Ga0466728_355186 | 3300042620 | Unclassified | 3933 |
| 121 | Ga0466735_145019 | 3300042624 | Bacteria | 2148 |
| 122 | Ga0466703_295814 | 3300042636 | Bacteria | 12277 |
| 123 | Ga0466704_042852 | 3300042643 | Bacteria | 11011 |
| 124 | Ga0466704_105636 | 3300042643 | Bacteria | 29340 |
| 125 | Ga0466704_501018 | 3300042643 | Bacteria | 3834 |
| 126 | Ga0466704_534766 | 3300042643 | Bacteria | 1747 |
| 127 | Ga0466708_059776 | 3300042652 | Bacteria | 7534 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02169 | LPP20 | LPP20 lipoprotein | 72 | 176 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.