Protein Family IF07169

Metagenome Isolate
139 Members
34 Samples
133 Scaffolds
549.42 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_271311|Ga0466705_271311_3935_5830
Length
631 aa
Sequence
VLKKGTAFFQLPQKIVNMALPGLPPGSGPPVSEKILITGLPATFRGEIGQNIDMRVMEAETLGELCLRAAAAYKKKRAFEIFRDGKVYDLVSYGEWGLRSRQFASLLGALGVKPGGRVMILAENCPEWPISYFGTALADAVSVPVLIDFSGEQIQNIAGHAEVSAICVTERTAPKCAGIDPAIPRIFIDTYEEAPLRVKKRGRSMDDIAESAEIRVSLGGTLRRLSLENRKSILPRREAGDLASIIYTSGTAGNSKGVMLSHRNLLFCAGASRKLMRIYPRDRLLSVIPLAHAYECTVGLLTAVMNGASITYLDKPPSPAVLLPAIQALRPTAMVTVPLFIEKIYRQKIAPALEASPLYRCPLTRPLALALAGRRLMAAFGGSIRFFGLGGAPLAADVEEFLRKVKFPYAPGYGLTETAPLLTGTAPYRFPGRSVGSVVPGVEIRIADGEIQARGPNVMMGYYRDEEGTREAFSPDGWLKTGDLGELDSRGRLYVRGRLKALILGPSGENIYPEEIEGLLNASGMVEDALVCPGEKGEIVALVVLNKKARAMINAAGEALEELKKKVNQQLASFSRLSRIEVKDEPFEKTPTHKIKRFLYGIQKPLDPKADPATGLPPGGSLFPGTSPGSA

πŸ“Š Sample Types

Isolate 4.3%
Metagenome 95.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Kalotermitidae 41.2%
Unclassified 26.5%
Termitidae 20.6%
Rhinotermitidae 5.9%
Termopsidae 5.9%

🌳 Taxonomy

Archaea 0
Bacteria 136
Eukaryota 0
Viruses 0
Unclassified 3

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
2 2781125697 Treponema sp. Th196P4bin17 Isolate Unclassified
3 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
4 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
5 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
6 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
7 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
8 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
17 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
18 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
19 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
20 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
21 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
22 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
23 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
26 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
27 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
28 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
29 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
30 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
31 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
32 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
33 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
34 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466704_588500 3300042643 Bacteria 2694
2 Ga0466727_063480 3300042655 Bacteria 8765
3 Ga0466713_108833 3300042602 Bacteria 2156
4 Ga0466716_281805 3300042605 Bacteria 3817
5 Ga0466719_088550 3300042606 Bacteria 22253
6 Ga0466719_277160 3300042606 Bacteria 12540
7 Ga0466719_423689 3300042606 Bacteria 3299
8 Ga0466722_111930 3300042609 Bacteria 16207
9 Ga0466711_446304 3300042615 Bacteria 2174
10 Ga0466715_051153 3300042616 Bacteria 4706
11 Ga0466715_292908 3300042616 Bacteria 7908
12 Ga0466715_355084 3300042616 Bacteria 10122
13 Ga0466726_366783 3300042619 Bacteria 27666
14 Ga0466691_049216 3300042593 Bacteria 5857
15 Ga0466691_167865 3300042593 Bacteria 14514
16 Ga0466694_070882 3300042594 Bacteria 6176
17 Ga0466696_485444 3300042596 Bacteria 2034
18 Ga0466705_095658 3300042612 Bacteria 3360
19 Ga0466703_010769 3300042636 Bacteria 8615
20 Ga0466703_095988 3300042636 Bacteria 3386
21 Ga0466704_122002 3300042643 Bacteria 30457
22 Ga0466704_182687 3300042643 Bacteria 8732
23 Ga0466704_357597 3300042643 Bacteria 27543
24 Ga0466707_376956 3300042601 Bacteria 3287
25 Ga0466713_026171 3300042602 Bacteria 44886
26 Ga0466719_124486 3300042606 Bacteria 2355
27 Ga0466711_162495 3300042615 Bacteria 17901
28 Ga0466723_014961 3300042618 Bacteria 2658
29 Ga0466723_097907 3300042618 Bacteria 21508
30 Ga0466723_129256 3300042618 Bacteria 14892
31 Ga0466723_130490 3300042618 Bacteria 37311
32 Ga0466723_134464 3300042618 Bacteria 3781
33 Ga0466723_184630 3300042618 Bacteria 5689
34 Ga0466728_103171 3300042620 Bacteria 16669
35 Ga0123357_10000302 3300009784 Bacteria 47106
36 Ga0123357_10003171 3300009784 Bacteria 18712
37 Ga0123353_10007431 3300010167 Bacteria 14798
38 Ga0466690_142920 3300042590 Bacteria 26948
39 Ga0466692_142303 3300042591 Bacteria 11124
40 Ga0466691_049012 3300042593 Bacteria 72676
41 Ga0466705_097602 3300042612 Bacteria 4995
42 Ga0466705_110406 3300042612 Bacteria 13237
43 Ga0466705_288417 3300042612 Bacteria 14872
44 Ga0466703_011058 3300042636 Bacteria 10546
45 Ga0466703_116450 3300042636 Bacteria 8401
46 Ga0466703_155935 3300042636 Bacteria 32957
47 Ga0466704_117890 3300042643 Bacteria 8548
48 Ga0466727_297500 3300042655 Bacteria 2815
49 Ga0466707_028708 3300042601 Bacteria 2651
50 Ga0466707_256611 3300042601 Bacteria 1802
51 Ga0466716_232051 3300042605 Bacteria 3466
52 Ga0466722_230751 3300042609 Bacteria 2557
53 Ga0466712_081403 3300042614 Bacteria 5468
54 Ga0466715_023475 3300042616 Bacteria 4972
55 Ga0466715_318882 3300042616 Bacteria 2832
56 Ga0466723_207114 3300042618 Bacteria 2660
57 JGI24702J35022_10003945 3300002462 Bacteria 8915
58 Ga0123357_10216647 3300009784 Bacteria 2136
59 Ga0466705_260067 3300042612 Bacteria 32862
60 Ga0466705_301165 3300042612 Bacteria 2670
61 Ga0466703_127538 3300042636 Bacteria 5442
62 Ga0466704_243546 3300042643 Bacteria 2372
63 Ga0466709_376046 3300042648 Bacteria 4151
64 Ga0466708_143885 3300042652 Bacteria 3141
65 Ga0466707_243324 3300042601 Bacteria 3176
66 Ga0466722_153465 3300042609 Bacteria 12546
67 Ga0466715_118861 3300042616 Bacteria 20979
68 Ga0466726_034522 3300042619 Bacteria 6769
69 Ga0466726_334055 3300042619 Bacteria 3785
70 Ga0466691_149240 3300042593 Bacteria 9541
71 Ga0466696_009889 3300042596 Bacteria 3852
72 Ga0466696_026532 3300042596 Bacteria 30218
73 Ga0466696_036398 3300042596 Bacteria 21968
74 Ga0466696_084141 3300042596 Bacteria 13334
75 Ga0466696_181188 3300042596 Bacteria 26938
76 Ga0466703_160805 3300042636 Bacteria 11268
77 Ga0466704_239917 3300042643 Bacteria 52442
78 Ga0466709_209965 3300042648 Bacteria 4612
79 Ga0466708_064700 3300042652 Bacteria 13699
80 Ga0466714_061799 3300042603 Bacteria 9766
81 Ga0466719_441410 3300042606 Bacteria 3012
82 Ga0466723_102905 3300042618 Bacteria 8977
83 Ga0466728_278655 3300042620 Bacteria 3789
84 Ga0123357_10038556 3300009784 Bacteria 6506
85 Ga0123353_10362507 3300010167 Bacteria 2177
86 Ga0466690_009541 3300042590 Bacteria 9709
87 Ga0466690_130140 3300042590 Bacteria 3536
88 Ga0466692_151505 3300042591 Bacteria 3486
89 Ga0466691_051419 3300042593 Bacteria 2994
90 Ga0466699_144593 3300042597 Bacteria 21273
91 Ga0466703_116782 3300042636 Bacteria 5169
92 Ga0466709_042965 3300042648 Bacteria 15358
93 Ga0466709_209552 3300042648 Bacteria 15383
94 Ga0466708_110091 3300042652 Bacteria 4004
95 Ga0466716_254268 3300042605 Bacteria 5400
96 Ga0466719_190072 3300042606 Bacteria 9720
97 Ga0466722_016171 3300042609 Bacteria 13736
98 Ga0466705_425681 3300042612 Bacteria 4534
99 Ga0466711_046351 3300042615 Bacteria 5291
100 Ga0466715_037413 3300042616 Bacteria 2680
101 Ga0466715_066323 3300042616 Bacteria 14582
102 Ga0466723_278246 3300042618 Unclassified 2405
103 Ga0466726_103367 3300042619 Bacteria 25672
104 Ga0466690_082983 3300042590 Bacteria 2424
105 Ga0466690_107045 3300042590 Bacteria 5122
106 Ga0466705_204513 3300042612 Bacteria 8817
107 Ga0466704_273989 3300042643 Bacteria 40108
108 Ga0466704_328878 3300042643 Bacteria 2343
109 Ga0466709_020639 3300042648 Bacteria 3352
110 Ga0466708_328999 3300042652 Bacteria 34433
111 Ga0466719_297251 3300042606 Bacteria 8240
112 Ga0466722_083961 3300042609 Unclassified 3492
113 Ga0466722_200946 3300042609 Bacteria 10626
114 Ga0466722_208058 3300042609 Bacteria 4041
115 Ga0466711_324170 3300042615 Bacteria 7971
116 Ga0466715_214932 3300042616 Bacteria 3896
117 Ga0466715_616341 3300042616 Bacteria 3355
118 Ga0466723_087129 3300042618 Bacteria 8950
119 Ga0466726_010703 3300042619 Bacteria 3049
120 Ga0466726_151322 3300042619 Bacteria 5060
121 Ga0466728_371819 3300042620 Bacteria 2066
122 JGI24702J35022_10007243 3300002462 Bacteria 6372
123 Ga0068305_10250197 3300005083 Bacteria 11124
124 Ga0466690_072701 3300042590 Bacteria 19918
125 Ga0466692_063115 3300042591 Bacteria 5393
126 Ga0466699_046280 3300042597 Bacteria 20535
127 Ga0466705_271311 3300042612 Bacteria 5873
128 Ga0466708_168156 3300042652 Bacteria 1953
129 Ga0466716_107515 3300042605 Unclassified 2374
130 Ga0466728_434293 3300042620 Bacteria 7001
131 Ga0466690_385057 3300042590 Bacteria 3404
132 Ga0466692_027843 3300042591 Bacteria 5851
133 Ga0466691_219584 3300042593 Bacteria 4361

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF23562 507 597 0.84
PF00501 AMP-binding AMP-binding enzyme 68 463 0.81

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.