Protein Family IF07169
Metagenome
Isolate
139
Members
34
Samples
133
Scaffolds
549.42
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_271311|Ga0466705_271311_3935_5830
- Length
- 631 aa
- Sequence
- VLKKGTAFFQLPQKIVNMALPGLPPGSGPPVSEKILITGLPATFRGEIGQNIDMRVMEAETLGELCLRAAAAYKKKRAFEIFRDGKVYDLVSYGEWGLRSRQFASLLGALGVKPGGRVMILAENCPEWPISYFGTALADAVSVPVLIDFSGEQIQNIAGHAEVSAICVTERTAPKCAGIDPAIPRIFIDTYEEAPLRVKKRGRSMDDIAESAEIRVSLGGTLRRLSLENRKSILPRREAGDLASIIYTSGTAGNSKGVMLSHRNLLFCAGASRKLMRIYPRDRLLSVIPLAHAYECTVGLLTAVMNGASITYLDKPPSPAVLLPAIQALRPTAMVTVPLFIEKIYRQKIAPALEASPLYRCPLTRPLALALAGRRLMAAFGGSIRFFGLGGAPLAADVEEFLRKVKFPYAPGYGLTETAPLLTGTAPYRFPGRSVGSVVPGVEIRIADGEIQARGPNVMMGYYRDEEGTREAFSPDGWLKTGDLGELDSRGRLYVRGRLKALILGPSGENIYPEEIEGLLNASGMVEDALVCPGEKGEIVALVVLNKKARAMINAAGEALEELKKKVNQQLASFSRLSRIEVKDEPFEKTPTHKIKRFLYGIQKPLDPKADPATGLPPGGSLFPGTSPGSA
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
41.2%
Unclassified
26.5%
Termitidae
20.6%
Rhinotermitidae
5.9%
Termopsidae
5.9%
Taxonomy
Archaea
0
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 2 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 3 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 19 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 20 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 29 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 32 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 33 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 34 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466704_588500 | 3300042643 | Bacteria | 2694 |
| 2 | Ga0466727_063480 | 3300042655 | Bacteria | 8765 |
| 3 | Ga0466713_108833 | 3300042602 | Bacteria | 2156 |
| 4 | Ga0466716_281805 | 3300042605 | Bacteria | 3817 |
| 5 | Ga0466719_088550 | 3300042606 | Bacteria | 22253 |
| 6 | Ga0466719_277160 | 3300042606 | Bacteria | 12540 |
| 7 | Ga0466719_423689 | 3300042606 | Bacteria | 3299 |
| 8 | Ga0466722_111930 | 3300042609 | Bacteria | 16207 |
| 9 | Ga0466711_446304 | 3300042615 | Bacteria | 2174 |
| 10 | Ga0466715_051153 | 3300042616 | Bacteria | 4706 |
| 11 | Ga0466715_292908 | 3300042616 | Bacteria | 7908 |
| 12 | Ga0466715_355084 | 3300042616 | Bacteria | 10122 |
| 13 | Ga0466726_366783 | 3300042619 | Bacteria | 27666 |
| 14 | Ga0466691_049216 | 3300042593 | Bacteria | 5857 |
| 15 | Ga0466691_167865 | 3300042593 | Bacteria | 14514 |
| 16 | Ga0466694_070882 | 3300042594 | Bacteria | 6176 |
| 17 | Ga0466696_485444 | 3300042596 | Bacteria | 2034 |
| 18 | Ga0466705_095658 | 3300042612 | Bacteria | 3360 |
| 19 | Ga0466703_010769 | 3300042636 | Bacteria | 8615 |
| 20 | Ga0466703_095988 | 3300042636 | Bacteria | 3386 |
| 21 | Ga0466704_122002 | 3300042643 | Bacteria | 30457 |
| 22 | Ga0466704_182687 | 3300042643 | Bacteria | 8732 |
| 23 | Ga0466704_357597 | 3300042643 | Bacteria | 27543 |
| 24 | Ga0466707_376956 | 3300042601 | Bacteria | 3287 |
| 25 | Ga0466713_026171 | 3300042602 | Bacteria | 44886 |
| 26 | Ga0466719_124486 | 3300042606 | Bacteria | 2355 |
| 27 | Ga0466711_162495 | 3300042615 | Bacteria | 17901 |
| 28 | Ga0466723_014961 | 3300042618 | Bacteria | 2658 |
| 29 | Ga0466723_097907 | 3300042618 | Bacteria | 21508 |
| 30 | Ga0466723_129256 | 3300042618 | Bacteria | 14892 |
| 31 | Ga0466723_130490 | 3300042618 | Bacteria | 37311 |
| 32 | Ga0466723_134464 | 3300042618 | Bacteria | 3781 |
| 33 | Ga0466723_184630 | 3300042618 | Bacteria | 5689 |
| 34 | Ga0466728_103171 | 3300042620 | Bacteria | 16669 |
| 35 | Ga0123357_10000302 | 3300009784 | Bacteria | 47106 |
| 36 | Ga0123357_10003171 | 3300009784 | Bacteria | 18712 |
| 37 | Ga0123353_10007431 | 3300010167 | Bacteria | 14798 |
| 38 | Ga0466690_142920 | 3300042590 | Bacteria | 26948 |
| 39 | Ga0466692_142303 | 3300042591 | Bacteria | 11124 |
| 40 | Ga0466691_049012 | 3300042593 | Bacteria | 72676 |
| 41 | Ga0466705_097602 | 3300042612 | Bacteria | 4995 |
| 42 | Ga0466705_110406 | 3300042612 | Bacteria | 13237 |
| 43 | Ga0466705_288417 | 3300042612 | Bacteria | 14872 |
| 44 | Ga0466703_011058 | 3300042636 | Bacteria | 10546 |
| 45 | Ga0466703_116450 | 3300042636 | Bacteria | 8401 |
| 46 | Ga0466703_155935 | 3300042636 | Bacteria | 32957 |
| 47 | Ga0466704_117890 | 3300042643 | Bacteria | 8548 |
| 48 | Ga0466727_297500 | 3300042655 | Bacteria | 2815 |
| 49 | Ga0466707_028708 | 3300042601 | Bacteria | 2651 |
| 50 | Ga0466707_256611 | 3300042601 | Bacteria | 1802 |
| 51 | Ga0466716_232051 | 3300042605 | Bacteria | 3466 |
| 52 | Ga0466722_230751 | 3300042609 | Bacteria | 2557 |
| 53 | Ga0466712_081403 | 3300042614 | Bacteria | 5468 |
| 54 | Ga0466715_023475 | 3300042616 | Bacteria | 4972 |
| 55 | Ga0466715_318882 | 3300042616 | Bacteria | 2832 |
| 56 | Ga0466723_207114 | 3300042618 | Bacteria | 2660 |
| 57 | JGI24702J35022_10003945 | 3300002462 | Bacteria | 8915 |
| 58 | Ga0123357_10216647 | 3300009784 | Bacteria | 2136 |
| 59 | Ga0466705_260067 | 3300042612 | Bacteria | 32862 |
| 60 | Ga0466705_301165 | 3300042612 | Bacteria | 2670 |
| 61 | Ga0466703_127538 | 3300042636 | Bacteria | 5442 |
| 62 | Ga0466704_243546 | 3300042643 | Bacteria | 2372 |
| 63 | Ga0466709_376046 | 3300042648 | Bacteria | 4151 |
| 64 | Ga0466708_143885 | 3300042652 | Bacteria | 3141 |
| 65 | Ga0466707_243324 | 3300042601 | Bacteria | 3176 |
| 66 | Ga0466722_153465 | 3300042609 | Bacteria | 12546 |
| 67 | Ga0466715_118861 | 3300042616 | Bacteria | 20979 |
| 68 | Ga0466726_034522 | 3300042619 | Bacteria | 6769 |
| 69 | Ga0466726_334055 | 3300042619 | Bacteria | 3785 |
| 70 | Ga0466691_149240 | 3300042593 | Bacteria | 9541 |
| 71 | Ga0466696_009889 | 3300042596 | Bacteria | 3852 |
| 72 | Ga0466696_026532 | 3300042596 | Bacteria | 30218 |
| 73 | Ga0466696_036398 | 3300042596 | Bacteria | 21968 |
| 74 | Ga0466696_084141 | 3300042596 | Bacteria | 13334 |
| 75 | Ga0466696_181188 | 3300042596 | Bacteria | 26938 |
| 76 | Ga0466703_160805 | 3300042636 | Bacteria | 11268 |
| 77 | Ga0466704_239917 | 3300042643 | Bacteria | 52442 |
| 78 | Ga0466709_209965 | 3300042648 | Bacteria | 4612 |
| 79 | Ga0466708_064700 | 3300042652 | Bacteria | 13699 |
| 80 | Ga0466714_061799 | 3300042603 | Bacteria | 9766 |
| 81 | Ga0466719_441410 | 3300042606 | Bacteria | 3012 |
| 82 | Ga0466723_102905 | 3300042618 | Bacteria | 8977 |
| 83 | Ga0466728_278655 | 3300042620 | Bacteria | 3789 |
| 84 | Ga0123357_10038556 | 3300009784 | Bacteria | 6506 |
| 85 | Ga0123353_10362507 | 3300010167 | Bacteria | 2177 |
| 86 | Ga0466690_009541 | 3300042590 | Bacteria | 9709 |
| 87 | Ga0466690_130140 | 3300042590 | Bacteria | 3536 |
| 88 | Ga0466692_151505 | 3300042591 | Bacteria | 3486 |
| 89 | Ga0466691_051419 | 3300042593 | Bacteria | 2994 |
| 90 | Ga0466699_144593 | 3300042597 | Bacteria | 21273 |
| 91 | Ga0466703_116782 | 3300042636 | Bacteria | 5169 |
| 92 | Ga0466709_042965 | 3300042648 | Bacteria | 15358 |
| 93 | Ga0466709_209552 | 3300042648 | Bacteria | 15383 |
| 94 | Ga0466708_110091 | 3300042652 | Bacteria | 4004 |
| 95 | Ga0466716_254268 | 3300042605 | Bacteria | 5400 |
| 96 | Ga0466719_190072 | 3300042606 | Bacteria | 9720 |
| 97 | Ga0466722_016171 | 3300042609 | Bacteria | 13736 |
| 98 | Ga0466705_425681 | 3300042612 | Bacteria | 4534 |
| 99 | Ga0466711_046351 | 3300042615 | Bacteria | 5291 |
| 100 | Ga0466715_037413 | 3300042616 | Bacteria | 2680 |
| 101 | Ga0466715_066323 | 3300042616 | Bacteria | 14582 |
| 102 | Ga0466723_278246 | 3300042618 | Unclassified | 2405 |
| 103 | Ga0466726_103367 | 3300042619 | Bacteria | 25672 |
| 104 | Ga0466690_082983 | 3300042590 | Bacteria | 2424 |
| 105 | Ga0466690_107045 | 3300042590 | Bacteria | 5122 |
| 106 | Ga0466705_204513 | 3300042612 | Bacteria | 8817 |
| 107 | Ga0466704_273989 | 3300042643 | Bacteria | 40108 |
| 108 | Ga0466704_328878 | 3300042643 | Bacteria | 2343 |
| 109 | Ga0466709_020639 | 3300042648 | Bacteria | 3352 |
| 110 | Ga0466708_328999 | 3300042652 | Bacteria | 34433 |
| 111 | Ga0466719_297251 | 3300042606 | Bacteria | 8240 |
| 112 | Ga0466722_083961 | 3300042609 | Unclassified | 3492 |
| 113 | Ga0466722_200946 | 3300042609 | Bacteria | 10626 |
| 114 | Ga0466722_208058 | 3300042609 | Bacteria | 4041 |
| 115 | Ga0466711_324170 | 3300042615 | Bacteria | 7971 |
| 116 | Ga0466715_214932 | 3300042616 | Bacteria | 3896 |
| 117 | Ga0466715_616341 | 3300042616 | Bacteria | 3355 |
| 118 | Ga0466723_087129 | 3300042618 | Bacteria | 8950 |
| 119 | Ga0466726_010703 | 3300042619 | Bacteria | 3049 |
| 120 | Ga0466726_151322 | 3300042619 | Bacteria | 5060 |
| 121 | Ga0466728_371819 | 3300042620 | Bacteria | 2066 |
| 122 | JGI24702J35022_10007243 | 3300002462 | Bacteria | 6372 |
| 123 | Ga0068305_10250197 | 3300005083 | Bacteria | 11124 |
| 124 | Ga0466690_072701 | 3300042590 | Bacteria | 19918 |
| 125 | Ga0466692_063115 | 3300042591 | Bacteria | 5393 |
| 126 | Ga0466699_046280 | 3300042597 | Bacteria | 20535 |
| 127 | Ga0466705_271311 | 3300042612 | Bacteria | 5873 |
| 128 | Ga0466708_168156 | 3300042652 | Bacteria | 1953 |
| 129 | Ga0466716_107515 | 3300042605 | Unclassified | 2374 |
| 130 | Ga0466728_434293 | 3300042620 | Bacteria | 7001 |
| 131 | Ga0466690_385057 | 3300042590 | Bacteria | 3404 |
| 132 | Ga0466692_027843 | 3300042591 | Bacteria | 5851 |
| 133 | Ga0466691_219584 | 3300042593 | Bacteria | 4361 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.