Protein Family IF07068
Metagenome
Isolate
104
Members
31
Samples
103
Scaffolds
339.28
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_059929|Ga0466705_059929_10959_12137
- Length
- 392 aa
- Sequence
- MPRNGEANAGAPPESGVFERFRVFFIKAPRMPVPCIYPEVSMKKLFLKGGAPSAGRSRPAAAVFAALAAIVVSCSTGEAVEQILGGSAAAPVFISCRAVSPTEIDFHFSTAVRVLSLNFSPDLEAGTSSEGNMVRVSLASAAGEGARLTADLLVEDARGNTLNVLVPLRARNDRMPPFLINELRTEHSKPKTEFIELKTTGPGSLGALRLFIAGNAKQPLVYEFPPAEVKKGEYIVIHLRNIEEGTADETGADXXIXXXADAQGDARDFWIPGSGKLLHKTDAVYFLDQDDRVIDGVMLSENPDPRWKKDHFAQAAEFLHGQGAWAQIPPGDTGGAVPGPADAVHTAAVKTAMTRSVSRDETAADTNTAADWYVTATGGATPGKPNNPKRFE
Sample Types
Isolate
1.0%
Metagenome
99.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
46.7%
Termitidae
23.3%
Rhinotermitidae
10.0%
Unclassified
10.0%
Termopsidae
6.7%
Blaberidae
3.3%
Taxonomy
Archaea
0
Bacteria
98
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 20 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 21 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 22 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 23 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 24 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_112480 | 3300024493 | Bacteria | 7766 |
| 2 | Ga0466696_038136 | 3300042596 | Bacteria | 24965 |
| 3 | Ga0466720_023642 | 3300042607 | Bacteria | 4937 |
| 4 | Ga0466720_035397 | 3300042607 | Bacteria | 15228 |
| 5 | Ga0466722_230831 | 3300042609 | Bacteria | 11349 |
| 6 | Ga0466711_100242 | 3300042615 | Bacteria | 5339 |
| 7 | Ga0466711_137705 | 3300042615 | Bacteria | 18389 |
| 8 | Ga0466723_015663 | 3300042618 | Bacteria | 58778 |
| 9 | Ga0466729_149324 | 3300042621 | Bacteria | 1142 |
| 10 | Ga0466731_276331 | 3300042622 | Bacteria | 3439 |
| 11 | Ga0466709_088329 | 3300042648 | Bacteria | 11205 |
| 12 | Ga0466708_137098 | 3300042652 | Bacteria | 3910 |
| 13 | Ga0466727_176254 | 3300042655 | Bacteria | 1922 |
| 14 | Ga0415639_100240 | 3300038395 | Unclassified | 1331 |
| 15 | Ga0466692_204205 | 3300042591 | Bacteria | 7486 |
| 16 | Ga0466716_138544 | 3300042605 | Bacteria | 6471 |
| 17 | Ga0466722_047115 | 3300042609 | Bacteria | 2116 |
| 18 | Ga0466722_052243 | 3300042609 | Bacteria | 23183 |
| 19 | Ga0466722_072985 | 3300042609 | Bacteria | 33307 |
| 20 | Ga0466711_462329 | 3300042615 | Bacteria | 30482 |
| 21 | Ga0466715_097861 | 3300042616 | Bacteria | 28870 |
| 22 | Ga0466715_271261 | 3300042616 | Bacteria | 5364 |
| 23 | Ga0466723_062733 | 3300042618 | Bacteria | 35703 |
| 24 | Ga0466723_084546 | 3300042618 | Bacteria | 4945 |
| 25 | Ga0466726_031006 | 3300042619 | Bacteria | 20841 |
| 26 | Ga0466731_287596 | 3300042622 | Bacteria | 1615 |
| 27 | Ga0466709_035429 | 3300042648 | Bacteria | 8310 |
| 28 | Ga0466708_169734 | 3300042652 | Bacteria | 12525 |
| 29 | Ga0466727_255723 | 3300042655 | Bacteria | 1343 |
| 30 | Ga0466691_089028 | 3300042593 | Bacteria | 39976 |
| 31 | Ga0466715_282627 | 3300042616 | Bacteria | 4316 |
| 32 | Ga0466726_093307 | 3300042619 | Bacteria | 3491 |
| 33 | Ga0466705_062540 | 3300042612 | Unclassified | 10012 |
| 34 | Ga0466705_121424 | 3300042612 | Bacteria | 14439 |
| 35 | Ga0466705_185419 | 3300042612 | Bacteria | 16741 |
| 36 | Ga0466705_238594 | 3300042612 | Bacteria | 4988 |
| 37 | Ga0466704_045874 | 3300042643 | Bacteria | 2356 |
| 38 | Ga0466704_179992 | 3300042643 | Bacteria | 35247 |
| 39 | Ga0466704_515376 | 3300042643 | Bacteria | 3987 |
| 40 | Ga0466704_565861 | 3300042643 | Bacteria | 62930 |
| 41 | Ga0466709_317002 | 3300042648 | Bacteria | 7009 |
| 42 | Ga0466708_038994 | 3300042652 | Bacteria | 9046 |
| 43 | Ga0466708_100401 | 3300042652 | Bacteria | 3869 |
| 44 | Ga0466708_124385 | 3300042652 | Bacteria | 5885 |
| 45 | Ga0466708_160197 | 3300042652 | Bacteria | 15593 |
| 46 | Ga0466708_368631 | 3300042652 | Bacteria | 10645 |
| 47 | Ga0466727_311108 | 3300042655 | Bacteria | 4392 |
| 48 | Ga0466696_303336 | 3300042596 | Bacteria | 19247 |
| 49 | Ga0466713_078093 | 3300042602 | Unclassified | 2358 |
| 50 | Ga0466719_077038 | 3300042606 | Unclassified | 2010 |
| 51 | Ga0466712_324189 | 3300042614 | Bacteria | 7264 |
| 52 | Ga0466715_038085 | 3300042616 | Bacteria | 2201 |
| 53 | Ga0466715_069049 | 3300042616 | Unclassified | 12378 |
| 54 | Ga0466723_136914 | 3300042618 | Bacteria | 3396 |
| 55 | JGI24695J34938_10000080 | 3300002450 | Bacteria | 82616 |
| 56 | Ga0466709_071557 | 3300042648 | Bacteria | 14177 |
| 57 | Ga0466708_354169 | 3300042652 | Bacteria | 9019 |
| 58 | Ga0466696_391482 | 3300042596 | Bacteria | 6167 |
| 59 | Ga0466707_073684 | 3300042601 | Bacteria | 21760 |
| 60 | Ga0466719_421406 | 3300042606 | Bacteria | 13928 |
| 61 | Ga0466715_130506 | 3300042616 | Bacteria | 5014 |
| 62 | Ga0466723_260481 | 3300042618 | Bacteria | 12284 |
| 63 | Ga0466728_452306 | 3300042620 | Bacteria | 5166 |
| 64 | Ga0466704_115155 | 3300042643 | Bacteria | 14950 |
| 65 | Ga0466709_401044 | 3300042648 | Bacteria | 10574 |
| 66 | Ga0466696_229954 | 3300042596 | Bacteria | 12821 |
| 67 | Ga0466700_039108 | 3300042600 | Bacteria | 9355 |
| 68 | Ga0466707_091611 | 3300042601 | Bacteria | 4213 |
| 69 | Ga0466716_137405 | 3300042605 | Bacteria | 2918 |
| 70 | Ga0466722_097332 | 3300042609 | Bacteria | 6544 |
| 71 | Ga0123353_10668910 | 3300010167 | Bacteria | 1465 |
| 72 | Ga0466705_388098 | 3300042612 | Bacteria | 2065 |
| 73 | Ga0466711_069804 | 3300042615 | Bacteria | 1392 |
| 74 | Ga0466711_077910 | 3300042615 | Bacteria | 5629 |
| 75 | Ga0466711_124715 | 3300042615 | Bacteria | 8934 |
| 76 | Ga0466711_346755 | 3300042615 | Bacteria | 5298 |
| 77 | Ga0466723_196774 | 3300042618 | Bacteria | 9391 |
| 78 | Ga0466703_065868 | 3300042636 | Bacteria | 21346 |
| 79 | Ga0466703_390324 | 3300042636 | Bacteria | 9390 |
| 80 | Ga0466709_313719 | 3300042648 | Bacteria | 10898 |
| 81 | Ga0466696_018386 | 3300042596 | Bacteria | 22730 |
| 82 | Ga0466716_250886 | 3300042605 | Bacteria | 5695 |
| 83 | Ga0466722_205735 | 3300042609 | Bacteria | 5520 |
| 84 | Ga0466715_049759 | 3300042616 | Bacteria | 3541 |
| 85 | Ga0466715_270811 | 3300042616 | Bacteria | 16378 |
| 86 | Ga0466723_035164 | 3300042618 | Bacteria | 5075 |
| 87 | Ga0466726_382028 | 3300042619 | Bacteria | 14308 |
| 88 | Ga0466703_362182 | 3300042636 | Bacteria | 4742 |
| 89 | Ga0466704_112645 | 3300042643 | Bacteria | 5690 |
| 90 | Ga0466709_347446 | 3300042648 | Bacteria | 5417 |
| 91 | Ga0466690_029256 | 3300042590 | Bacteria | 4541 |
| 92 | Ga0466690_331869 | 3300042590 | Unclassified | 2862 |
| 93 | Ga0466692_060612 | 3300042591 | Bacteria | 8954 |
| 94 | Ga0466719_268321 | 3300042606 | Bacteria | 2683 |
| 95 | Ga0466719_345398 | 3300042606 | Bacteria | 10216 |
| 96 | Ga0466720_072156 | 3300042607 | Bacteria | 2848 |
| 97 | Ga0466722_067468 | 3300042609 | Bacteria | 5628 |
| 98 | Ga0466711_435155 | 3300042615 | Bacteria | 4009 |
| 99 | Ga0466715_368617 | 3300042616 | Bacteria | 16621 |
| 100 | Ga0068305_10079296 | 3300005083 | Bacteria | 4280 |
| 101 | Ga0466705_059929 | 3300042612 | Bacteria | 14929 |
| 102 | Ga0466703_388393 | 3300042636 | Bacteria | 5529 |
| 103 | Ga0466709_091133 | 3300042648 | Bacteria | 5412 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.