Protein Family IF07050
Metagenome
103
Members
17
Samples
103
Scaffolds
310.73
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_028680|Ga0466705_028680_3517_4536
- Length
- 339 aa
- Sequence
- MTPRSSLSANIHFFKSIFIMKILKIHFSYLRNEAHYQFLLLVKKLFEDYPGVAGIVNILLTQFYTLLTLEGKLVDAVRTSGYTEQLVKTDKRLNRAVTGLSLAIETASHHPDPNIVKAAGSLIIRMKAFRNGIKQKAYEEKSGAVKILITDLQSAYAPQVSTLGLGVWVTEIITAQATFEQLFLLRSAEHVEQPQGCLKDVRIEIDTIYRQAMERIEGYTAMNGTDVTGIFINKLNDETAYFNRHYRHRRVPKDINLATVASIPVQPWNGRPVTPLPSVTDEDGNELFFGRDYDLKYHNNDCPGNATVTLQGRSAWKGKKTVSFNIVKNDGSQLSTDSF
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
76.5%
Termopsidae
17.6%
Rhinotermitidae
5.9%
Taxonomy
Archaea
0
Bacteria
86
Eukaryota
1
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 4 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 5 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 6 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 7 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 8 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 14 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 15 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 16 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 17 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_008414 | 3300042612 | Unclassified | 1250 |
| 2 | Ga0466690_059420 | 3300042590 | Bacteria | 3820 |
| 3 | Ga0466696_231722 | 3300042596 | Bacteria | 21210 |
| 4 | Ga0466703_084037 | 3300042636 | Bacteria | 1838 |
| 5 | Ga0466703_146377 | 3300042636 | Unclassified | 1520 |
| 6 | Ga0466703_311151 | 3300042636 | Bacteria | 1110 |
| 7 | Ga0466704_374491 | 3300042643 | Bacteria | 2105 |
| 8 | Ga0466708_037832 | 3300042652 | Bacteria | 9758 |
| 9 | Ga0466711_328071 | 3300042615 | Unclassified | 1791 |
| 10 | Ga0466715_196153 | 3300042616 | Bacteria | 2624 |
| 11 | Ga0466715_417277 | 3300042616 | Bacteria | 1142 |
| 12 | Ga0466728_169824 | 3300042620 | Bacteria | 3057 |
| 13 | Ga0466691_072336 | 3300042593 | Bacteria | 1560 |
| 14 | Ga0466719_119286 | 3300042606 | Bacteria | 1068 |
| 15 | Ga0068302_10227028 | 3300005071 | Unclassified | 1373 |
| 16 | Ga0466704_451882 | 3300042643 | Bacteria | 23178 |
| 17 | Ga0466704_583377 | 3300042643 | Bacteria | 1754 |
| 18 | Ga0466708_159771 | 3300042652 | Bacteria | 2585 |
| 19 | Ga0466715_163089 | 3300042616 | Bacteria | 3330 |
| 20 | Ga0466715_466686 | 3300042616 | Bacteria | 1476 |
| 21 | Ga0466723_135882 | 3300042618 | Bacteria | 78165 |
| 22 | Ga0466726_344730 | 3300042619 | Unclassified | 1026 |
| 23 | Ga0466705_017677 | 3300042612 | Unclassified | 1787 |
| 24 | Ga0466705_022737 | 3300042612 | Unclassified | 1733 |
| 25 | Ga0466705_182890 | 3300042612 | Bacteria | 1479 |
| 26 | Ga0466691_129572 | 3300042593 | Bacteria | 3045 |
| 27 | Ga0466719_078940 | 3300042606 | Bacteria | 1416 |
| 28 | Ga0466719_090412 | 3300042606 | Bacteria | 5079 |
| 29 | Ga0466703_181405 | 3300042636 | Eukaryota | 7898 |
| 30 | Ga0466703_185767 | 3300042636 | Bacteria | 1060 |
| 31 | Ga0466704_065180 | 3300042643 | Bacteria | 2670 |
| 32 | Ga0466704_075926 | 3300042643 | Bacteria | 6074 |
| 33 | Ga0466705_131873 | 3300042612 | Bacteria | 2199 |
| 34 | Ga0466705_177771 | 3300042612 | Unclassified | 5003 |
| 35 | Ga0466719_003177 | 3300042606 | Bacteria | 6026 |
| 36 | Ga0466719_075147 | 3300042606 | Bacteria | 1634 |
| 37 | Ga0466703_013190 | 3300042636 | Bacteria | 16034 |
| 38 | Ga0466703_180200 | 3300042636 | Bacteria | 19638 |
| 39 | Ga0466703_423604 | 3300042636 | Bacteria | 2916 |
| 40 | Ga0466704_233778 | 3300042643 | Bacteria | 14890 |
| 41 | Ga0466704_307804 | 3300042643 | Bacteria | 3101 |
| 42 | Ga0466704_585410 | 3300042643 | Bacteria | 2207 |
| 43 | Ga0466715_636760 | 3300042616 | Bacteria | 2818 |
| 44 | Ga0466723_172825 | 3300042618 | Bacteria | 28507 |
| 45 | Ga0466705_086343 | 3300042612 | Unclassified | 2526 |
| 46 | Ga0466705_142420 | 3300042612 | Bacteria | 9392 |
| 47 | Ga0466705_182027 | 3300042612 | Bacteria | 7274 |
| 48 | Ga0466705_279433 | 3300042612 | Unclassified | 2401 |
| 49 | Ga0466705_282360 | 3300042612 | Bacteria | 29228 |
| 50 | Ga0466691_028847 | 3300042593 | Bacteria | 14556 |
| 51 | Ga0466691_051501 | 3300042593 | Unclassified | 1598 |
| 52 | Ga0466691_115665 | 3300042593 | Bacteria | 5435 |
| 53 | Ga0466691_151946 | 3300042593 | Unclassified | 3339 |
| 54 | Ga0466696_238522 | 3300042596 | Unclassified | 3572 |
| 55 | Ga0466716_163075 | 3300042605 | Unclassified | 3089 |
| 56 | Ga0466719_162209 | 3300042606 | Bacteria | 1640 |
| 57 | Ga0466722_055337 | 3300042609 | Bacteria | 46327 |
| 58 | Ga0466704_080824 | 3300042643 | Bacteria | 2571 |
| 59 | Ga0466704_096367 | 3300042643 | Bacteria | 13890 |
| 60 | Ga0466704_173765 | 3300042643 | Bacteria | 1502 |
| 61 | Ga0466704_318750 | 3300042643 | Bacteria | 1597 |
| 62 | Ga0466704_450880 | 3300042643 | Bacteria | 13298 |
| 63 | Ga0466704_519608 | 3300042643 | Bacteria | 4827 |
| 64 | Ga0466708_231998 | 3300042652 | Bacteria | 1889 |
| 65 | Ga0466727_214224 | 3300042655 | Bacteria | 1400 |
| 66 | Ga0466705_442566 | 3300042612 | Bacteria | 7209 |
| 67 | Ga0466723_030183 | 3300042618 | Bacteria | 23821 |
| 68 | Ga0466726_271765 | 3300042619 | Bacteria | 10902 |
| 69 | Ga0466705_142264 | 3300042612 | Bacteria | 11837 |
| 70 | Ga0466719_510717 | 3300042606 | Bacteria | 1874 |
| 71 | Ga0466703_228299 | 3300042636 | Bacteria | 1822 |
| 72 | Ga0466703_275696 | 3300042636 | Bacteria | 2739 |
| 73 | Ga0466704_025074 | 3300042643 | Unclassified | 3197 |
| 74 | Ga0466704_323171 | 3300042643 | Bacteria | 2705 |
| 75 | Ga0466708_114162 | 3300042652 | Bacteria | 1994 |
| 76 | Ga0466708_141958 | 3300042652 | Bacteria | 25092 |
| 77 | Ga0466711_361529 | 3300042615 | Bacteria | 5923 |
| 78 | Ga0466723_080889 | 3300042618 | Bacteria | 6388 |
| 79 | Ga0466691_002118 | 3300042593 | Unclassified | 2191 |
| 80 | Ga0466691_024810 | 3300042593 | Bacteria | 1628 |
| 81 | Ga0466696_064485 | 3300042596 | Bacteria | 19188 |
| 82 | Ga0466703_006583 | 3300042636 | Bacteria | 3948 |
| 83 | Ga0466703_062623 | 3300042636 | Bacteria | 13940 |
| 84 | Ga0466704_059765 | 3300042643 | Bacteria | 4558 |
| 85 | Ga0466727_305150 | 3300042655 | Bacteria | 1375 |
| 86 | Ga0466711_179484 | 3300042615 | Bacteria | 4926 |
| 87 | Ga0466711_287866 | 3300042615 | Bacteria | 20432 |
| 88 | Ga0466723_028395 | 3300042618 | Bacteria | 3918 |
| 89 | Ga0466705_028680 | 3300042612 | Bacteria | 8548 |
| 90 | Ga0466705_333831 | 3300042612 | Bacteria | 8995 |
| 91 | Ga0466690_051226 | 3300042590 | Bacteria | 2010 |
| 92 | Ga0466696_447883 | 3300042596 | Bacteria | 2540 |
| 93 | Ga0466716_276377 | 3300042605 | Bacteria | 3516 |
| 94 | Ga0466719_364941 | 3300042606 | Bacteria | 4697 |
| 95 | Ga0466703_162016 | 3300042636 | Bacteria | 4172 |
| 96 | Ga0466704_205695 | 3300042643 | Bacteria | 8224 |
| 97 | Ga0466704_516266 | 3300042643 | Bacteria | 4237 |
| 98 | Ga0466708_009163 | 3300042652 | Bacteria | 1428 |
| 99 | Ga0466708_353078 | 3300042652 | Bacteria | 21631 |
| 100 | Ga0466727_216177 | 3300042655 | Bacteria | 10782 |
| 101 | Ga0466711_496211 | 3300042615 | Bacteria | 2616 |
| 102 | Ga0466715_469557 | 3300042616 | Bacteria | 2240 |
| 103 | Ga0466726_013143 | 3300042619 | Bacteria | 12145 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF19775 | DUF6261 | Family of unknown function (DUF6261) | 83 | 236 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.