Protein Family IF07046
Metagenome
Isolate
112
Members
33
Samples
107
Scaffolds
460.17
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_024148|Ga0466705_024148_4708_6321
- Length
- 537 aa
- Sequence
- MRRFSLAACLVFFALGLLPLWGQTADSGEESAAGSPSAESGIFAPEGEGEPVAAGPAPITGVEAVIDSAEELAGELEQTIAPGETLWNYAGRMGIALGIIAVQALIIWVFWRHFFKFITRKTVGYFGERIKPLTIKKLRILSTKQIIGLIVFGIKIVKYIFTVFLLVFTIPVVFALFPGTRDLAVTLFGYIFNPFKNIVFGTIAYIPNLITIAVIIVVTRYVLRALKFFAIQIEREKLVIPGFYADWANPTFNILRVLLYAFTVAIIYPYLPGSDSRIFQGVSVLVGVIFSLGSSSAIGNLVAGLVITYMRPFKIGDRIKINDVTGFVVEKTLMVIRLKTHKNEYVTFPNLMILNSSVVNYHTSSDEDEEGLVLYATVTFGYGTPWQTVQEILINAALSTSHILKNPKPFVLQTALNDFYANYQVNCYSKEIDRVPRIYSELYQHIQEGFRAAGIDMTAPQFRINMPYEDPFPVKISSPRPRGRVVQKQAIPAQPVDSADSGAGLKDAAPEISAEPGPANTRKAPVRRRSKSTPPSP
Sample Types
Isolate
4.5%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
40.6%
Termitidae
25.0%
Unclassified
18.8%
Termopsidae
9.4%
Rhinotermitidae
6.2%
Taxonomy
Archaea
0
Bacteria
111
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 21 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 22 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 23 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 24 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 25 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 26 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 27 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 32 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_100876 | 3300042612 | Bacteria | 24455 |
| 2 | Ga0466705_140924 | 3300042612 | Bacteria | 10301 |
| 3 | Ga0068302_10077748 | 3300005071 | Bacteria | 2650 |
| 4 | Ga0466715_364611 | 3300042616 | Bacteria | 6005 |
| 5 | Ga0466728_053260 | 3300042620 | Bacteria | 9497 |
| 6 | Ga0466690_137839 | 3300042590 | Bacteria | 4093 |
| 7 | Ga0466703_035757 | 3300042636 | Bacteria | 2334 |
| 8 | Ga0466708_157489 | 3300042652 | Bacteria | 3376 |
| 9 | Ga0466708_174298 | 3300042652 | Bacteria | 4857 |
| 10 | Ga0466727_162803 | 3300042655 | Bacteria | 8707 |
| 11 | Ga0466707_098000 | 3300042601 | Bacteria | 2280 |
| 12 | Ga0466716_052896 | 3300042605 | Bacteria | 3022 |
| 13 | Ga0466705_003041 | 3300042612 | Bacteria | 14560 |
| 14 | JGI24695J34938_10003827 | 3300002450 | Bacteria | 10221 |
| 15 | JGI24705J35276_12210089 | 3300002504 | Bacteria | 1815 |
| 16 | Ga0466705_409626 | 3300042612 | Bacteria | 4773 |
| 17 | Ga0466723_225559 | 3300042618 | Bacteria | 5093 |
| 18 | Ga0466723_301396 | 3300042618 | Bacteria | 4055 |
| 19 | Ga0264413_117243 | 3300024493 | Bacteria | 11479 |
| 20 | Ga0466692_177158 | 3300042591 | Bacteria | 17341 |
| 21 | Ga0466694_075570 | 3300042594 | Bacteria | 6141 |
| 22 | Ga0466703_339673 | 3300042636 | Bacteria | 5130 |
| 23 | Ga0466704_028522 | 3300042643 | Bacteria | 14017 |
| 24 | Ga0466704_111914 | 3300042643 | Bacteria | 32572 |
| 25 | Ga0466709_399285 | 3300042648 | Bacteria | 22927 |
| 26 | Ga0466716_116894 | 3300042605 | Bacteria | 1731 |
| 27 | Ga0466716_314219 | 3300042605 | Bacteria | 7681 |
| 28 | Ga0466705_077908 | 3300042612 | Bacteria | 11680 |
| 29 | Ga0466705_232051 | 3300042612 | Bacteria | 14272 |
| 30 | Ga0466715_077254 | 3300042616 | Bacteria | 24143 |
| 31 | Ga0466718_134009 | 3300042617 | Bacteria | 4780 |
| 32 | Ga0466723_010496 | 3300042618 | Bacteria | 9348 |
| 33 | Ga0466728_090686 | 3300042620 | Bacteria | 6917 |
| 34 | Ga0466692_152387 | 3300042591 | Bacteria | 29225 |
| 35 | Ga0466694_187026 | 3300042594 | Bacteria | 18469 |
| 36 | Ga0466696_027634 | 3300042596 | Bacteria | 23130 |
| 37 | Ga0466696_342909 | 3300042596 | Bacteria | 12307 |
| 38 | Ga0466703_057057 | 3300042636 | Bacteria | 18027 |
| 39 | Ga0466703_239566 | 3300042636 | Bacteria | 29253 |
| 40 | Ga0466704_160027 | 3300042643 | Bacteria | 29575 |
| 41 | Ga0466704_493462 | 3300042643 | Unclassified | 1543 |
| 42 | Ga0466708_034220 | 3300042652 | Bacteria | 21029 |
| 43 | Ga0466708_105112 | 3300042652 | Bacteria | 2378 |
| 44 | Ga0466716_197566 | 3300042605 | Bacteria | 4135 |
| 45 | Ga0466720_026420 | 3300042607 | Bacteria | 22729 |
| 46 | Ga0466705_010388 | 3300042612 | Bacteria | 6412 |
| 47 | Ga0466705_060007 | 3300042612 | Bacteria | 8177 |
| 48 | Ga0466732_248977 | 3300042656 | Bacteria | 20366 |
| 49 | Ga0466728_204507 | 3300042620 | Bacteria | 2960 |
| 50 | Ga0123353_10075402 | 3300010167 | Bacteria | 5420 |
| 51 | Ga0466722_120548 | 3300042609 | Bacteria | 6323 |
| 52 | Ga0466705_284019 | 3300042612 | Bacteria | 3705 |
| 53 | JGI24698J34947_10012514 | 3300002449 | Bacteria | 4649 |
| 54 | Ga0466728_448237 | 3300042620 | Bacteria | 5956 |
| 55 | Ga0466690_150462 | 3300042590 | Bacteria | 3957 |
| 56 | Ga0466692_114466 | 3300042591 | Bacteria | 2016 |
| 57 | Ga0466735_217604 | 3300042624 | Bacteria | 6456 |
| 58 | Ga0466703_317506 | 3300042636 | Bacteria | 4950 |
| 59 | Ga0466703_330124 | 3300042636 | Bacteria | 6556 |
| 60 | Ga0466703_413621 | 3300042636 | Bacteria | 8368 |
| 61 | Ga0466704_126982 | 3300042643 | Bacteria | 13499 |
| 62 | Ga0466704_404880 | 3300042643 | Bacteria | 9656 |
| 63 | Ga0466709_093376 | 3300042648 | Bacteria | 8279 |
| 64 | Ga0466708_047578 | 3300042652 | Bacteria | 2785 |
| 65 | Ga0466727_240936 | 3300042655 | Bacteria | 2156 |
| 66 | Ga0466719_149063 | 3300042606 | Bacteria | 15996 |
| 67 | Ga0466719_307289 | 3300042606 | Bacteria | 3494 |
| 68 | Ga0466722_255003 | 3300042609 | Bacteria | 12062 |
| 69 | Ga0466705_061823 | 3300042612 | Bacteria | 3204 |
| 70 | Ga0466705_340117 | 3300042612 | Bacteria | 13635 |
| 71 | Ga0466711_383554 | 3300042615 | Bacteria | 20506 |
| 72 | Ga0466715_015169 | 3300042616 | Bacteria | 13317 |
| 73 | Ga0466723_055854 | 3300042618 | Bacteria | 8501 |
| 74 | Ga0466723_163359 | 3300042618 | Bacteria | 4331 |
| 75 | Ga0466694_043334 | 3300042594 | Bacteria | 6214 |
| 76 | Ga0466696_210225 | 3300042596 | Bacteria | 27277 |
| 77 | Ga0466703_136148 | 3300042636 | Bacteria | 13546 |
| 78 | Ga0466703_204530 | 3300042636 | Bacteria | 2673 |
| 79 | Ga0466703_333259 | 3300042636 | Bacteria | 21872 |
| 80 | Ga0466708_160776 | 3300042652 | Bacteria | 7921 |
| 81 | Ga0466705_024148 | 3300042612 | Bacteria | 8680 |
| 82 | JGI24698J34947_10015487 | 3300002449 | Bacteria | 4149 |
| 83 | JGI24695J34938_10000137 | 3300002450 | Bacteria | 66242 |
| 84 | Ga0466718_122701 | 3300042617 | Bacteria | 9837 |
| 85 | Ga0466728_033874 | 3300042620 | Bacteria | 17572 |
| 86 | Ga0466728_080341 | 3300042620 | Bacteria | 4321 |
| 87 | Ga0466728_120589 | 3300042620 | Bacteria | 4191 |
| 88 | Ga0466703_100281 | 3300042636 | Bacteria | 6606 |
| 89 | Ga0466704_264549 | 3300042643 | Bacteria | 13510 |
| 90 | Ga0466704_428013 | 3300042643 | Bacteria | 23996 |
| 91 | Ga0466708_015554 | 3300042652 | Bacteria | 30533 |
| 92 | Ga0466727_318735 | 3300042655 | Bacteria | 3455 |
| 93 | Ga0466716_069741 | 3300042605 | Bacteria | 8666 |
| 94 | Ga0466716_204379 | 3300042605 | Bacteria | 3610 |
| 95 | Ga0466711_465990 | 3300042615 | Bacteria | 11790 |
| 96 | Ga0466715_054399 | 3300042616 | Bacteria | 7080 |
| 97 | Ga0466715_612056 | 3300042616 | Bacteria | 3892 |
| 98 | Ga0466723_218471 | 3300042618 | Bacteria | 5002 |
| 99 | Ga0466728_020291 | 3300042620 | Bacteria | 11173 |
| 100 | Ga0466690_359453 | 3300042590 | Bacteria | 3545 |
| 101 | Ga0466696_013382 | 3300042596 | Bacteria | 35562 |
| 102 | Ga0466703_231435 | 3300042636 | Bacteria | 27613 |
| 103 | Ga0466704_088959 | 3300042643 | Bacteria | 8055 |
| 104 | Ga0466704_134875 | 3300042643 | Bacteria | 11065 |
| 105 | Ga0466716_458646 | 3300042605 | Bacteria | 28728 |
| 106 | Ga0466719_472322 | 3300042606 | Bacteria | 1852 |
| 107 | Ga0466722_158251 | 3300042609 | Bacteria | 2926 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.