Protein Family IF06961
Metagenome
Isolate
125
Members
47
Samples
123
Scaffolds
258.08
Avg Length
Representative Sequence
- ID
- 3300042610|Ga0466698_449876|Ga0466698_449876_168_1067
- Length
- 299 aa
- Sequence
- MGQSLCWRLQGRIVAQIATGEKKIKRQAKDASRSRQQRGQSAMKIRMLSWNVNGLRAISAKPEWSWFKNSAADIVALQETKAAPEQLASELRAPAGWHAGWSSSVVKKGYSGVAVFSRTEPLLIREELPDPAFRGEGRLVHLEYPAFHFLAVYFPNGGEENRRVPYKMAFYDAFLLHVQDLRRTKPLVVCGDFNTAHAEIDLARPKQNENTTGFLPEERAWMDAFTAAGYVDTFRHVHGQVAGAYTWWSYRQGARRTNVGWRIDYFFTSRELLPAIRNAWIEKDVHGSDHCPVGLELEL
Sample Types
Isolate
1.6%
Metagenome
98.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.4%
Kalotermitidae
31.1%
Unclassified
8.9%
Termopsidae
8.9%
Rhinotermitidae
6.7%
Taxonomy
Archaea
1
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 5 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 6 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 7 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 11 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 12 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 17 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 18 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 21 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 24 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 25 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 26 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 27 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 28 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 29 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 2820044805 | Unclassified Proteobacteria Th196P4bin15 | Isolate | Unclassified |
| 37 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 41 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 42 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 43 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 44 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 45 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 46 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 47 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123353_10491912 | 3300010167 | Bacteria | 1791 |
| 2 | Ga0072941_1262030 | 3300005201 | Bacteria | 1045 |
| 3 | Ga0264413_128257 | 3300024493 | Bacteria | 4869 |
| 4 | Ga0466701_102004 | 3300042598 | Bacteria | 5698 |
| 5 | Ga0466717_289486 | 3300042604 | Bacteria | 1096 |
| 6 | Ga0466716_098301 | 3300042605 | Bacteria | 6381 |
| 7 | Ga0466703_090946 | 3300042636 | Bacteria | 4285 |
| 8 | Ga0466704_229062 | 3300042643 | Bacteria | 13146 |
| 9 | Ga0466708_008051 | 3300042652 | Bacteria | 1781 |
| 10 | Ga0466708_370403 | 3300042652 | Bacteria | 1137 |
| 11 | Ga0466712_065710 | 3300042614 | Bacteria | 1148 |
| 12 | Ga0466711_079301 | 3300042615 | Bacteria | 9544 |
| 13 | Ga0466726_102842 | 3300042619 | Bacteria | 3922 |
| 14 | Ga0123353_10597147 | 3300010167 | Bacteria | 1579 |
| 15 | Ga0123353_10850100 | 3300010167 | Bacteria | 1251 |
| 16 | JGI24698J34947_10007827 | 3300002449 | Bacteria | 5869 |
| 17 | JGI24698J34947_10100083 | 3300002449 | Bacteria | 1306 |
| 18 | Ga0466691_225642 | 3300042593 | Bacteria | 85197 |
| 19 | Ga0466696_405851 | 3300042596 | Bacteria | 28381 |
| 20 | Ga0466716_185390 | 3300042605 | Bacteria | 27438 |
| 21 | Ga0466719_051408 | 3300042606 | Bacteria | 1261 |
| 22 | Ga0466719_217662 | 3300042606 | Bacteria | 2370 |
| 23 | Ga0466719_254288 | 3300042606 | Bacteria | 2985 |
| 24 | Ga0466719_331741 | 3300042606 | Bacteria | 24471 |
| 25 | Ga0466708_293095 | 3300042652 | Bacteria | 4156 |
| 26 | Ga0466727_318695 | 3300042655 | Bacteria | 3057 |
| 27 | Ga0466711_163751 | 3300042615 | Bacteria | 5235 |
| 28 | Ga0466723_073445 | 3300042618 | Bacteria | 67522 |
| 29 | Ga0466726_056722 | 3300042619 | Bacteria | 11309 |
| 30 | Ga0123357_10001974 | 3300009784 | Bacteria | 22438 |
| 31 | Ga0466695_213576 | 3300042595 | Bacteria | 4622 |
| 32 | Ga0466696_389282 | 3300042596 | Bacteria | 5980 |
| 33 | Ga0466700_181380 | 3300042600 | Bacteria | 1501 |
| 34 | Ga0466717_182282 | 3300042604 | Unclassified | 1402 |
| 35 | Ga0466729_232740 | 3300042621 | Bacteria | 1154 |
| 36 | Ga0466703_119095 | 3300042636 | Bacteria | 16693 |
| 37 | Ga0466709_166132 | 3300042648 | Bacteria | 5359 |
| 38 | Ga0466712_277646 | 3300042614 | Bacteria | 1888 |
| 39 | Ga0466715_114308 | 3300042616 | Bacteria | 5948 |
| 40 | Ga0123357_10467995 | 3300009784 | Bacteria | 1077 |
| 41 | Ga0123356_11186300 | 3300010049 | Bacteria | 930 |
| 42 | Ga0466691_033243 | 3300042593 | Bacteria | 1282 |
| 43 | Ga0466713_106285 | 3300042602 | Bacteria | 2427 |
| 44 | Ga0466716_296428 | 3300042605 | Bacteria | 2302 |
| 45 | Ga0466698_178188 | 3300042610 | Bacteria | 2709 |
| 46 | Ga0466705_062368 | 3300042612 | Bacteria | 6844 |
| 47 | Ga0466735_163932 | 3300042624 | Bacteria | 1706 |
| 48 | Ga0466704_258296 | 3300042643 | Bacteria | 7907 |
| 49 | Ga0466709_144763 | 3300042648 | Bacteria | 1986 |
| 50 | Ga0466725_394106 | 3300042654 | Bacteria | 1874 |
| 51 | Ga0466712_159988 | 3300042614 | Bacteria | 1025 |
| 52 | Ga0466715_288828 | 3300042616 | Bacteria | 18849 |
| 53 | Ga0466723_175652 | 3300042618 | Bacteria | 41824 |
| 54 | Ga0123357_10247435 | 3300009784 | Bacteria | 1916 |
| 55 | Ga0123353_10135563 | 3300010167 | Bacteria | 3948 |
| 56 | Ga0068302_10019483 | 3300005071 | Bacteria | 5707 |
| 57 | Ga0072940_1275570 | 3300005200 | Bacteria | 1155 |
| 58 | Ga0466694_363184 | 3300042594 | Bacteria | 5532 |
| 59 | Ga0466707_116763 | 3300042601 | Bacteria | 3118 |
| 60 | Ga0466698_247589 | 3300042610 | Bacteria | 1299 |
| 61 | Ga0466735_136968 | 3300042624 | Bacteria | 1167 |
| 62 | Ga0466703_296491 | 3300042636 | Unclassified | 1231 |
| 63 | Ga0466704_376558 | 3300042643 | Unclassified | 71218 |
| 64 | Ga0466708_106623 | 3300042652 | Bacteria | 34173 |
| 65 | Ga0466711_513350 | 3300042615 | Bacteria | 9422 |
| 66 | Ga0466723_326724 | 3300042618 | Bacteria | 5284 |
| 67 | Ga0466726_409579 | 3300042619 | Bacteria | 3330 |
| 68 | Ga0466728_231062 | 3300042620 | Bacteria | 10677 |
| 69 | Ga0466729_134072 | 3300042621 | Bacteria | 2999 |
| 70 | Ga0466690_029701 | 3300042590 | Bacteria | 8580 |
| 71 | Ga0466692_172967 | 3300042591 | Bacteria | 17796 |
| 72 | Ga0466691_101246 | 3300042593 | Bacteria | 6446 |
| 73 | Ga0466716_343406 | 3300042605 | Bacteria | 6997 |
| 74 | Ga0466719_248759 | 3300042606 | Bacteria | 2029 |
| 75 | Ga0466719_479516 | 3300042606 | Unclassified | 3272 |
| 76 | Ga0466697_138697 | 3300042611 | Bacteria | 1678 |
| 77 | Ga0466735_155122 | 3300042624 | Bacteria | 2635 |
| 78 | Ga0466703_397178 | 3300042636 | Bacteria | 1625 |
| 79 | Ga0466704_177901 | 3300042643 | Bacteria | 1512 |
| 80 | Ga0466705_427691 | 3300042612 | Bacteria | 5854 |
| 81 | Ga0466710_188094 | 3300042613 | Bacteria | 1265 |
| 82 | Ga0466712_322017 | 3300042614 | Bacteria | 16906 |
| 83 | Ga0466715_286076 | 3300042616 | Bacteria | 13194 |
| 84 | Ga0466718_121824 | 3300042617 | Bacteria | 1661 |
| 85 | Ga0466723_141827 | 3300042618 | Bacteria | 6436 |
| 86 | Ga0466728_254550 | 3300042620 | Bacteria | 6144 |
| 87 | Ga0466729_015332 | 3300042621 | Bacteria | 1065 |
| 88 | Ga0123356_10260532 | 3300010049 | Bacteria | 1817 |
| 89 | Ga0123353_10330883 | 3300010167 | Unclassified | 2306 |
| 90 | Ga0123354_10035153 | 3300010882 | Bacteria | 7826 |
| 91 | JGI24698J34947_10056056 | 3300002449 | Bacteria | 1961 |
| 92 | JGI24702J35022_10008767 | 3300002462 | Bacteria | 5710 |
| 93 | JGI24705J35276_12194183 | 3300002504 | Bacteria | 1508 |
| 94 | Ga0466657_010771 | 3300042582 | Bacteria | 1277 |
| 95 | Ga0466690_137081 | 3300042590 | Bacteria | 37774 |
| 96 | Ga0466707_373814 | 3300042601 | Bacteria | 5293 |
| 97 | Ga0466716_268443 | 3300042605 | Bacteria | 106882 |
| 98 | Ga0466719_150329 | 3300042606 | Bacteria | 9424 |
| 99 | Ga0466719_203444 | 3300042606 | Bacteria | 5533 |
| 100 | Ga0466722_161423 | 3300042609 | Bacteria | 3096 |
| 101 | Ga0466705_226612 | 3300042612 | Bacteria | 1979 |
| 102 | Ga0466729_207463 | 3300042621 | Bacteria | 64397 |
| 103 | Ga0466735_073363 | 3300042624 | Bacteria | 3333 |
| 104 | Ga0466704_037586 | 3300042643 | Unclassified | 1403 |
| 105 | Ga0466704_408972 | 3300042643 | Bacteria | 12038 |
| 106 | Ga0466704_469559 | 3300042643 | Bacteria | 5902 |
| 107 | Ga0466718_117643 | 3300042617 | Bacteria | 10012 |
| 108 | Ga0466723_217381 | 3300042618 | Unclassified | 5794 |
| 109 | Ga0466726_116200 | 3300042619 | Unclassified | 3631 |
| 110 | Ga0123353_10942033 | 3300010167 | Bacteria | 1169 |
| 111 | Ga0466717_088881 | 3300042604 | Bacteria | 1380 |
| 112 | Ga0466719_097142 | 3300042606 | Bacteria | 22858 |
| 113 | Ga0466719_266835 | 3300042606 | Archaea | 3011 |
| 114 | Ga0466722_198809 | 3300042609 | Bacteria | 5197 |
| 115 | Ga0466698_449876 | 3300042610 | Bacteria | 2346 |
| 116 | Ga0466729_318336 | 3300042621 | Unclassified | 2968 |
| 117 | Ga0466735_173989 | 3300042624 | Bacteria | 4078 |
| 118 | Ga0466704_145291 | 3300042643 | Bacteria | 11527 |
| 119 | Ga0466709_338581 | 3300042648 | Bacteria | 14434 |
| 120 | Ga0466715_386787 | 3300042616 | Bacteria | 2005 |
| 121 | Ga0466715_425219 | 3300042616 | Bacteria | 5108 |
| 122 | Ga0466726_128370 | 3300042619 | Unclassified | 5330 |
| 123 | Ga0466729_170719 | 3300042621 | Bacteria | 1006 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03372 | Exo_endo_phos | Endonuclease/Exonuclease/phosphatase family | 48 | 290 | 0.8 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF03372 | GO:0003824 | catalytic activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.