Protein Family IF06685
Metagenome
Isolate
128
Members
32
Samples
122
Scaffolds
202.13
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_215064|Ga0466720_215064_136_831
- Length
- 231 aa
- Sequence
- MGALKGLRIFKLVIFSPETLETIYSLCYYIHMNMVCLDLEGVLVPEIWIAFSEATGISELRRTTRDEPDYNKLMNFRLDLLKKNNLKLPDIQKVISGMDPLPGAIDFTNALREKTQLIILSDTFEQFAKPLMAKLSYPTLFCNSLEVDKDGTVTGFHLRQQNGKKEAVKSFKSINMRIFAAGDSFNDLAMIREADGGCLFRAPEQIRKDCSDLKCVDTFYELLAEINNFLN
Sample Types
Isolate
4.7%
Metagenome
95.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
60.0%
Unclassified
20.0%
Kalotermitidae
13.3%
Rhinotermitidae
3.3%
Termopsidae
3.3%
Taxonomy
Archaea
0
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 4 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 5 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 6 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 7 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 8 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 11 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 12 | 2740892545 | Fibrobacteria bacterium GUT31 IN01_31 | Isolate | Unclassified |
| 13 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 14 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 19 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 20 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 21 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 22 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 23 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 24 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 25 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 26 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 27 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 28 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 29 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 30 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 31 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466692_087276 | 3300042591 | Bacteria | 2265 |
| 2 | Ga0466694_378886 | 3300042594 | Bacteria | 1796 |
| 3 | Ga0466720_215064 | 3300042607 | Bacteria | 2101 |
| 4 | Ga0466731_128418 | 3300042622 | Bacteria | 2035 |
| 5 | 2230969789 | 2228664004 | Unclassified | 2664 |
| 6 | JGI24698J34947_10001915 | 3300002449 | Bacteria | 11080 |
| 7 | JGI24698J34947_10001940 | 3300002449 | Bacteria | 11020 |
| 8 | JGI24698J34947_10075305 | 3300002449 | Bacteria | 1605 |
| 9 | JGI24695J34938_10006724 | 3300002450 | Bacteria | 6846 |
| 10 | JGI24695J34938_10033232 | 3300002450 | Bacteria | 2375 |
| 11 | JGI24697J35500_11235738 | 3300002507 | Bacteria | 2121 |
| 12 | Ga0072941_1002863 | 3300005201 | Bacteria | 7094 |
| 13 | Ga0466712_021071 | 3300042614 | Bacteria | 4173 |
| 14 | Ga0466712_048083 | 3300042614 | Bacteria | 13720 |
| 15 | Ga0466712_159242 | 3300042614 | Bacteria | 52985 |
| 16 | Ga0123356_10011633 | 3300010049 | Bacteria | 8572 |
| 17 | Ga0123356_10012362 | 3300010049 | Bacteria | 8289 |
| 18 | Ga0466732_152935 | 3300042656 | Bacteria | 17753 |
| 19 | Ga0466694_027819 | 3300042594 | Bacteria | 46301 |
| 20 | Ga0466694_064498 | 3300042594 | Bacteria | 26637 |
| 21 | Ga0466700_320410 | 3300042600 | Bacteria | 1834 |
| 22 | Ga0466703_255896 | 3300042636 | Bacteria | 9648 |
| 23 | AustNasuHG_c1000418 | 3300000089 | Bacteria | 14754 |
| 24 | JGI24698J34947_10003385 | 3300002449 | Bacteria | 8655 |
| 25 | JGI24698J34947_10017434 | 3300002449 | Bacteria | 3892 |
| 26 | JGI24698J34947_10164530 | 3300002449 | Unclassified | 905 |
| 27 | JGI24695J34938_10009805 | 3300002450 | Bacteria | 5298 |
| 28 | JGI24695J34938_10104671 | 3300002450 | Bacteria | 1155 |
| 29 | Ga0072941_1026189 | 3300005201 | Bacteria | 7530 |
| 30 | Ga0466712_023315 | 3300042614 | Bacteria | 46913 |
| 31 | Ga0466712_047161 | 3300042614 | Bacteria | 4622 |
| 32 | Ga0466712_131420 | 3300042614 | Bacteria | 1196 |
| 33 | Ga0466732_178678 | 3300042656 | Bacteria | 2025 |
| 34 | Ga0466692_112402 | 3300042591 | Bacteria | 5189 |
| 35 | Ga0466692_114096 | 3300042591 | Bacteria | 4997 |
| 36 | Ga0466694_128020 | 3300042594 | Bacteria | 3428 |
| 37 | Ga0466694_401746 | 3300042594 | Bacteria | 2968 |
| 38 | Ga0466735_043248 | 3300042624 | Bacteria | 1689 |
| 39 | JGI24698J34947_10062782 | 3300002449 | Bacteria | 1823 |
| 40 | JGI24698J34947_10117034 | 3300002449 | Unclassified | 1165 |
| 41 | JGI24695J34938_10006421 | 3300002450 | Bacteria | 7068 |
| 42 | Ga0072941_1040887 | 3300005201 | Bacteria | 12276 |
| 43 | Ga0466712_006450 | 3300042614 | Bacteria | 2131 |
| 44 | Ga0466712_314515 | 3300042614 | Unclassified | 1308 |
| 45 | Ga0123356_10004986 | 3300010049 | Bacteria | 13616 |
| 46 | Ga0466733_022257 | 3300042659 | Bacteria | 5758 |
| 47 | Ga0415639_022355 | 3300038395 | Bacteria | 12756 |
| 48 | Ga0466694_008904 | 3300042594 | Bacteria | 2668 |
| 49 | Ga0466696_050960 | 3300042596 | Bacteria | 12180 |
| 50 | Ga0466720_017818 | 3300042607 | Bacteria | 23421 |
| 51 | JGI24698J34947_10002345 | 3300002449 | Bacteria | 10186 |
| 52 | JGI24698J34947_10012276 | 3300002449 | Bacteria | 4695 |
| 53 | JGI24698J34947_10053818 | 3300002449 | Bacteria | 2012 |
| 54 | JGI24698J34947_10061380 | 3300002449 | Bacteria | 1850 |
| 55 | JGI24698J34947_10155031 | 3300002449 | Bacteria | 946 |
| 56 | Ga0072941_1001189 | 3300005201 | Bacteria | 20096 |
| 57 | Ga0466712_046206 | 3300042614 | Bacteria | 6104 |
| 58 | Ga0466712_291440 | 3300042614 | Bacteria | 9458 |
| 59 | Ga0466718_150338 | 3300042617 | Bacteria | 1311 |
| 60 | Ga0123356_10000535 | 3300010049 | Bacteria | 42229 |
| 61 | Ga0123356_10011706 | 3300010049 | Bacteria | 8543 |
| 62 | Ga0466733_104580 | 3300042659 | Bacteria | 1730 |
| 63 | Ga0415639_247227 | 3300038395 | Bacteria | 1054 |
| 64 | Ga0466694_370962 | 3300042594 | Bacteria | 1449 |
| 65 | Ga0466720_214157 | 3300042607 | Bacteria | 15077 |
| 66 | JGI24698J34947_10017874 | 3300002449 | Bacteria | 3839 |
| 67 | JGI24698J34947_10027640 | 3300002449 | Bacteria | 3009 |
| 68 | JGI24698J34947_10028542 | 3300002449 | Bacteria | 2954 |
| 69 | JGI24698J34947_10046114 | 3300002449 | Bacteria | 2220 |
| 70 | JGI24698J34947_10155257 | 3300002449 | Bacteria | 944 |
| 71 | Ga0072940_1012405 | 3300005200 | Bacteria | 3862 |
| 72 | Ga0072941_1003046 | 3300005201 | Unclassified | 43335 |
| 73 | Ga0072941_1005148 | 3300005201 | Unclassified | 3732 |
| 74 | Ga0466712_016703 | 3300042614 | Bacteria | 2792 |
| 75 | Ga0466712_091910 | 3300042614 | Bacteria | 39871 |
| 76 | Ga0466712_092115 | 3300042614 | Bacteria | 1004 |
| 77 | Ga0466712_191899 | 3300042614 | Unclassified | 3469 |
| 78 | Ga0466712_201882 | 3300042614 | Unclassified | 3728 |
| 79 | Ga0415639_068684 | 3300038395 | Bacteria | 6756 |
| 80 | Ga0466694_134638 | 3300042594 | Bacteria | 58679 |
| 81 | Ga0466720_170720 | 3300042607 | Bacteria | 4188 |
| 82 | Ga0466702_160952 | 3300042635 | Bacteria | 4763 |
| 83 | JGI24698J34947_10003239 | 3300002449 | Bacteria | 8819 |
| 84 | JGI24698J34947_10004539 | 3300002449 | Bacteria | 7560 |
| 85 | JGI24698J34947_10007022 | 3300002449 | Bacteria | 6190 |
| 86 | JGI24698J34947_10024925 | 3300002449 | Bacteria | 3188 |
| 87 | JGI24695J34938_10001351 | 3300002450 | Bacteria | 21202 |
| 88 | JGI24695J34938_10004829 | 3300002450 | Bacteria | 8666 |
| 89 | JGI24695J34938_10036381 | 3300002450 | Bacteria | 2245 |
| 90 | JGI24697J35500_11263377 | 3300002507 | Bacteria | 3207 |
| 91 | Ga0466712_130029 | 3300042614 | Bacteria | 2278 |
| 92 | Ga0123356_10013365 | 3300010049 | Bacteria | 7929 |
| 93 | Ga0123356_10318950 | 3300010049 | Bacteria | 1666 |
| 94 | Ga0466732_358620 | 3300042656 | Unclassified | 1203 |
| 95 | Ga0264413_134498 | 3300024493 | Bacteria | 2301 |
| 96 | Ga0466716_279218 | 3300042605 | Bacteria | 1841 |
| 97 | Ga0466709_403605 | 3300042648 | Bacteria | 14680 |
| 98 | AustNasuHG_c1031887 | 3300000089 | Bacteria | 1476 |
| 99 | JGI24698J34947_10000249 | 3300002449 | Bacteria | 22641 |
| 100 | JGI24698J34947_10064263 | 3300002449 | Bacteria | 1794 |
| 101 | JGI24695J34938_10003240 | 3300002450 | Bacteria | 11520 |
| 102 | JGI24695J34938_10103451 | 3300002450 | Bacteria | 1162 |
| 103 | Ga0466718_024446 | 3300042617 | Bacteria | 9906 |
| 104 | Ga0466718_127697 | 3300042617 | Bacteria | 2392 |
| 105 | Ga0264413_121392 | 3300024493 | Bacteria | 8730 |
| 106 | Ga0466720_031803 | 3300042607 | Bacteria | 2297 |
| 107 | Ga0466720_044669 | 3300042607 | Bacteria | 23520 |
| 108 | Ga0466720_104161 | 3300042607 | Unclassified | 1729 |
| 109 | Ga0466698_295316 | 3300042610 | Bacteria | 7074 |
| 110 | AustNasuHG_c1012732 | 3300000089 | Bacteria | 2900 |
| 111 | JGI24698J34947_10001405 | 3300002449 | Bacteria | 12678 |
| 112 | JGI24698J34947_10008751 | 3300002449 | Unclassified | 5550 |
| 113 | JGI24698J34947_10010524 | 3300002449 | Bacteria | 5076 |
| 114 | JGI24698J34947_10013494 | 3300002449 | Bacteria | 4460 |
| 115 | JGI24695J34938_10001613 | 3300002450 | Bacteria | 18940 |
| 116 | Ga0072941_1026192 | 3300005201 | Bacteria | 9278 |
| 117 | Ga0072941_1071971 | 3300005201 | Bacteria | 1680 |
| 118 | Ga0466712_051941 | 3300042614 | Bacteria | 37403 |
| 119 | Ga0466712_135412 | 3300042614 | Bacteria | 1509 |
| 120 | Ga0466712_231357 | 3300042614 | Bacteria | 2038 |
| 121 | Ga0466718_031864 | 3300042617 | Bacteria | 2458 |
| 122 | Ga0466718_150465 | 3300042617 | Unclassified | 31408 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.