Protein Family IF06504
Metagenome
Isolate
135
Members
40
Samples
131
Scaffolds
189.99
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_171487|Ga0466719_171487_690_1331
- Length
- 213 aa
- Sequence
- MVSDTIFSVKNSPKRTIDVAKANRDNLEKLIVEYRPQLKSFIRKRVDNKEDAEDILQDVFYQLTKTVNIAISPVEEVAAWLYRVARNTIINHGMKKREEEMPVYQSDESDEEMQKDFSEVLFGNDSSPSPETEYLRSLVWEELENALAELPPEQREIFELTELDGIPVKEISQTIGLPVNTLLSRKHYAVLHLRKRLRQLYEDIVCCPFSYNK
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
32.5%
Termitidae
30.0%
Unclassified
15.0%
Termopsidae
10.0%
Rhinotermitidae
7.5%
Armadillidiidae
5.0%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820751898 | Unclassified Bacteroidetes Nc150P4bin22 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 11 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 12 | 3300012858 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E6 MG | Metagenome | Armadillidiidae |
| 13 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 14 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 15 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 28 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 29 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 30 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 32 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 33 | 3300012847 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972M_E1 MG | Metagenome | Armadillidiidae |
| 34 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466657_202266 | 3300042582 | Bacteria | 1883 |
| 2 | Ga0466692_122492 | 3300042591 | Bacteria | 20821 |
| 3 | Ga0466696_016243 | 3300042596 | Bacteria | 3141 |
| 4 | Ga0466696_051024 | 3300042596 | Bacteria | 4496 |
| 5 | Ga0466719_171487 | 3300042606 | Bacteria | 2219 |
| 6 | Ga0466721_032387 | 3300042608 | Bacteria | 1000 |
| 7 | Ga0123357_10000554 | 3300009784 | Bacteria | 36811 |
| 8 | Ga0466709_009237 | 3300042648 | Bacteria | 5158 |
| 9 | Ga0466715_090283 | 3300042616 | Bacteria | 4603 |
| 10 | Ga0466715_102773 | 3300042616 | Bacteria | 14137 |
| 11 | Ga0466726_038265 | 3300042619 | Bacteria | 1941 |
| 12 | Ga0466726_100720 | 3300042619 | Bacteria | 21924 |
| 13 | Ga0466726_205532 | 3300042619 | Bacteria | 1441 |
| 14 | Ga0466726_334856 | 3300042619 | Bacteria | 2439 |
| 15 | Ga0466692_083609 | 3300042591 | Bacteria | 19912 |
| 16 | Ga0466693_154358 | 3300042592 | Bacteria | 1055 |
| 17 | Ga0466696_032418 | 3300042596 | Bacteria | 11520 |
| 18 | Ga0466696_150158 | 3300042596 | Bacteria | 2848 |
| 19 | Ga0466696_391934 | 3300042596 | Bacteria | 1254 |
| 20 | Ga0466722_099105 | 3300042609 | Unclassified | 12520 |
| 21 | Ga0123354_10110845 | 3300010882 | Bacteria | 3625 |
| 22 | Ga0466704_605312 | 3300042643 | Bacteria | 3194 |
| 23 | Ga0466709_215401 | 3300042648 | Bacteria | 10069 |
| 24 | Ga0466727_105837 | 3300042655 | Bacteria | 8191 |
| 25 | Ga0466727_317143 | 3300042655 | Bacteria | 2989 |
| 26 | Ga0466711_087501 | 3300042615 | Bacteria | 13442 |
| 27 | Ga0466711_109594 | 3300042615 | Bacteria | 1542 |
| 28 | Ga0466711_233262 | 3300042615 | Bacteria | 2703 |
| 29 | Ga0466715_206916 | 3300042616 | Bacteria | 10776 |
| 30 | Ga0466715_386461 | 3300042616 | Unclassified | 10382 |
| 31 | Ga0466726_410265 | 3300042619 | Bacteria | 18631 |
| 32 | Ga0160457_1010010 | 3300012858 | Bacteria | 1349 |
| 33 | Ga0466691_221229 | 3300042593 | Bacteria | 5241 |
| 34 | Ga0466696_023019 | 3300042596 | Bacteria | 39682 |
| 35 | Ga0466707_205010 | 3300042601 | Bacteria | 11894 |
| 36 | Ga0466719_505544 | 3300042606 | Bacteria | 2830 |
| 37 | Ga0123357_10043236 | 3300009784 | Bacteria | 6122 |
| 38 | Ga0123357_10072434 | 3300009784 | Bacteria | 4567 |
| 39 | Ga0123357_10318871 | 3300009784 | Unclassified | 1539 |
| 40 | JGI24705J35276_12227672 | 3300002504 | Bacteria | 3041 |
| 41 | JGI24699J35502_11134148 | 3300002509 | Bacteria | 37810 |
| 42 | Ga0466711_121797 | 3300042615 | Bacteria | 24444 |
| 43 | Ga0466711_333830 | 3300042615 | Bacteria | 4689 |
| 44 | Ga0466715_413909 | 3300042616 | Bacteria | 3520 |
| 45 | Ga0466723_025949 | 3300042618 | Bacteria | 2875 |
| 46 | Ga0466696_038945 | 3300042596 | Bacteria | 11078 |
| 47 | Ga0466696_368943 | 3300042596 | Bacteria | 21298 |
| 48 | Ga0466707_413838 | 3300042601 | Bacteria | 9602 |
| 49 | Ga0466697_031126 | 3300042611 | Bacteria | 2801 |
| 50 | Ga0123357_10011205 | 3300009784 | Bacteria | 11477 |
| 51 | JGI24696J40584_12942119 | 3300002834 | Bacteria | 1730 |
| 52 | Ga0068302_10217650 | 3300005071 | Bacteria | 1267 |
| 53 | Ga0466703_128175 | 3300042636 | Bacteria | 1541 |
| 54 | Ga0466703_335909 | 3300042636 | Bacteria | 6779 |
| 55 | Ga0466704_513936 | 3300042643 | Bacteria | 7171 |
| 56 | Ga0466709_219886 | 3300042648 | Bacteria | 6449 |
| 57 | Ga0466727_117366 | 3300042655 | Bacteria | 2691 |
| 58 | Ga0466715_040385 | 3300042616 | Bacteria | 43736 |
| 59 | Ga0466715_096820 | 3300042616 | Bacteria | 3315 |
| 60 | Ga0466715_224258 | 3300042616 | Unclassified | 4291 |
| 61 | Ga0466715_394870 | 3300042616 | Bacteria | 1186 |
| 62 | Ga0466694_123992 | 3300042594 | Bacteria | 1081 |
| 63 | Ga0466707_210292 | 3300042601 | Bacteria | 4030 |
| 64 | Ga0466713_083759 | 3300042602 | Bacteria | 6909 |
| 65 | Ga0466716_149120 | 3300042605 | Bacteria | 6532 |
| 66 | Ga0466719_133809 | 3300042606 | Bacteria | 7876 |
| 67 | Ga0466719_164605 | 3300042606 | Bacteria | 4418 |
| 68 | Ga0123357_10000340 | 3300009784 | Bacteria | 44197 |
| 69 | Ga0466729_315948 | 3300042621 | Bacteria | 1409 |
| 70 | Ga0466735_064494 | 3300042624 | Bacteria | 1165 |
| 71 | Ga0466711_466775 | 3300042615 | Bacteria | 4349 |
| 72 | Ga0466715_314536 | 3300042616 | Bacteria | 2109 |
| 73 | Ga0466726_015187 | 3300042619 | Bacteria | 5515 |
| 74 | Ga0466726_208180 | 3300042619 | Unclassified | 2720 |
| 75 | Ga0466705_352435 | 3300042612 | Bacteria | 2142 |
| 76 | Ga0466696_043657 | 3300042596 | Bacteria | 18382 |
| 77 | Ga0466696_092398 | 3300042596 | Bacteria | 31103 |
| 78 | Ga0466713_041457 | 3300042602 | Bacteria | 2239 |
| 79 | Ga0466716_034808 | 3300042605 | Bacteria | 61138 |
| 80 | Ga0466719_007380 | 3300042606 | Bacteria | 5505 |
| 81 | Ga0466719_517957 | 3300042606 | Bacteria | 16533 |
| 82 | Ga0466722_143948 | 3300042609 | Bacteria | 3265 |
| 83 | JGI24699J35502_11134224 | 3300002509 | Bacteria | 74083 |
| 84 | Ga0466735_163049 | 3300042624 | Bacteria | 11294 |
| 85 | Ga0466709_254691 | 3300042648 | Bacteria | 6984 |
| 86 | Ga0466708_038801 | 3300042652 | Bacteria | 24839 |
| 87 | Ga0466727_144223 | 3300042655 | Bacteria | 7333 |
| 88 | Ga0466726_031790 | 3300042619 | Bacteria | 1149 |
| 89 | Ga0466726_138783 | 3300042619 | Bacteria | 1416 |
| 90 | Ga0466690_131475 | 3300042590 | Bacteria | 11949 |
| 91 | Ga0466713_054623 | 3300042602 | Bacteria | 24408 |
| 92 | Ga0123357_10087397 | 3300009784 | Bacteria | 4078 |
| 93 | Ga0123357_10456091 | 3300009784 | Bacteria | 1104 |
| 94 | JGI24705J35276_12218057 | 3300002504 | Bacteria | 2125 |
| 95 | JGI24705J35276_12236618 | 3300002504 | Bacteria | 8449 |
| 96 | Ga0466735_007951 | 3300042624 | Bacteria | 2782 |
| 97 | Ga0466735_131954 | 3300042624 | Bacteria | 2173 |
| 98 | Ga0466704_191027 | 3300042643 | Bacteria | 94994 |
| 99 | Ga0466727_149548 | 3300042655 | Bacteria | 9249 |
| 100 | Ga0466711_171422 | 3300042615 | Bacteria | 12098 |
| 101 | Ga0466711_455967 | 3300042615 | Bacteria | 4733 |
| 102 | Ga0466715_230808 | 3300042616 | Bacteria | 7861 |
| 103 | Ga0466715_260986 | 3300042616 | Bacteria | 30864 |
| 104 | Ga0466726_319027 | 3300042619 | Bacteria | 3860 |
| 105 | Ga0160445_108057 | 3300012847 | Unclassified | 1639 |
| 106 | Ga0466690_135003 | 3300042590 | Bacteria | 12831 |
| 107 | Ga0466690_170306 | 3300042590 | Bacteria | 7608 |
| 108 | Ga0466690_194464 | 3300042590 | Bacteria | 3386 |
| 109 | Ga0466696_241360 | 3300042596 | Unclassified | 3287 |
| 110 | Ga0466713_002688 | 3300042602 | Bacteria | 5146 |
| 111 | Ga0466716_270953 | 3300042605 | Bacteria | 1750 |
| 112 | Ga0466719_184868 | 3300042606 | Bacteria | 2403 |
| 113 | Ga0466697_016382 | 3300042611 | Bacteria | 1557 |
| 114 | Ga0123357_10081482 | 3300009784 | Bacteria | 4253 |
| 115 | Ga0123353_10140403 | 3300010167 | Bacteria | 3870 |
| 116 | Ga0123354_10001798 | 3300010882 | Bacteria | 27042 |
| 117 | JGI24702J35022_10013069 | 3300002462 | Bacteria | 4605 |
| 118 | JGI24705J35276_11912492 | 3300002504 | Bacteria | 761 |
| 119 | JGI24699J35502_11133853 | 3300002509 | Bacteria | 17134 |
| 120 | Ga0068302_10020230 | 3300005071 | Bacteria | 3822 |
| 121 | Ga0123357_10001341 | 3300009784 | Bacteria | 26019 |
| 122 | Ga0123357_10001876 | 3300009784 | Bacteria | 22825 |
| 123 | Ga0466709_227357 | 3300042648 | Bacteria | 3314 |
| 124 | Ga0466727_037894 | 3300042655 | Bacteria | 109077 |
| 125 | Ga0466727_243921 | 3300042655 | Bacteria | 3072 |
| 126 | Ga0466711_126600 | 3300042615 | Bacteria | 7596 |
| 127 | Ga0466715_070496 | 3300042616 | Bacteria | 9228 |
| 128 | Ga0466715_509861 | 3300042616 | Bacteria | 18242 |
| 129 | Ga0466715_643650 | 3300042616 | Bacteria | 11442 |
| 130 | Ga0466726_098237 | 3300042619 | Bacteria | 1743 |
| 131 | Ga0466726_198127 | 3300042619 | Bacteria | 1825 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.