Protein Family IF06437

Metagenome Isolate
129 Members
53 Samples
114 Scaffolds
309.13 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_541566|Ga0466716_541566_1063_2145
Length
360 aa
Sequence
MLEVSELLKKVRRIEIVANRAVNEFFAGQYKSVFRGRGMEFNEVREYQPGDDVRSIDWNVTARAGKPFIKRFVEERELTIIFLIDVSGSGIFGMHRSKIDAAIEVAATLMFSAIKNNDKVGLITFADRVIDYHRPRKGKANVLQLIRELLLIEPLATQTDLRQALDYVNRVQKRRAVIFLLSDFLVSGIVGNFQDELTSEMSQLNKVDAELSSGIRNGTRSRILGGSGSGIGSSRDLLDSFFNLQYSTSSRSAKSRSPQEKAISISSRKHDLVAMRLFDQREKEFPNVGLITIEDAETGELVEVDAANSTIRTLLAKQQKIGEDQIIETLKRCRVDQMSIETNQDYLTDLLRFFRRRKKF

📊 Sample Types

Isolate 11.6%
Metagenome 88.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 39.2%
Kalotermitidae 23.5%
Unclassified 19.6%
Apidae 9.8%
Termopsidae 3.9%
Passalidae 2.0%
Rhinotermitidae 2.0%

🌳 Taxonomy

Archaea 1
Bacteria 114
Eukaryota 0
Viruses 0
Unclassified 14

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
2 2778260935 Unclassified Fibrobacteres Co191P1bin79 Isolate Unclassified
3 2778260938 Unclassified Fibrobacteres Co191P3bin71 Isolate Unclassified
4 2785510743 Apibacter sp. ESL0404 Isolate Apidae
5 2820106212 Unclassified Proteobacteria Emb289P4bin44 Isolate Unclassified
6 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
7 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
8 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
11 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
12 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
13 2773857778 Unclassified Fibrobacteres Co191P1bin56 Isolate Unclassified
14 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
15 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
16 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
17 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
18 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
19 2832343623 Apibacter adventoris wkB180 Isolate Apidae
20 3300000036 Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) Metagenome Passalidae
21 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
22 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
26 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
27 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
28 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
29 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
30 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
31 2778260936 Unclassified Fibrobacteres Co191P3bin13 Isolate Unclassified
32 2820214248 Unclassified Kiritimatiellaeota Nt197P3bin16 Isolate Unclassified
33 2820719201 Unclassified Fibrobacteres Lab288P3bin119 Isolate Unclassified
34 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
35 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
36 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
37 3300000333 Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony Metagenome Apidae
38 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
39 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
40 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
41 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
42 2832298047 Apibacter sp. wkB309 Isolate Apidae
43 2799112231 Apibacter sp. ESL0432 Isolate Unclassified
44 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
45 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
46 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
47 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
48 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
49 2820111668 Unclassified Proteobacteria Emb289P4bin34 Isolate Unclassified
50 2832372155 Apibacter adventoris wkB301 Isolate Apidae
51 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
52 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
53 3300005200 Nasutitermes gut metagenome Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 IMNBGM34_c000362 3300000036 Bacteria 13001
2 AustNasuHG_c1012112 3300000089 Bacteria 2980
3 JGI24698J34947_10041231 3300002449 Bacteria 2379
4 Ga0072941_1027725 3300005201 Bacteria 13697
5 Ga0072941_1134932 3300005201 Bacteria 12664
6 Ga0123357_10000123 3300009784 Bacteria 66665
7 Ga0466705_111814 3300042612 Unclassified 2827
8 Ga0466731_042249 3300042622 Bacteria 5850
9 Ga0264413_148075 3300024493 Bacteria 6424
10 Ga0466690_192815 3300042590 Bacteria 2432
11 Ga0466711_175803 3300042615 Bacteria 25847
12 Ga0466715_467676 3300042616 Unclassified 8586
13 Ga0466715_504793 3300042616 Bacteria 44350
14 Ga0466718_094162 3300042617 Bacteria 9073
15 Ga0466723_371180 3300042618 Bacteria 15144
16 Ga0466726_045084 3300042619 Bacteria 10687
17 Ga0466719_198023 3300042606 Unclassified 4293
18 Ga0466731_152422 3300042622 Bacteria 3298
19 Ga0466735_073980 3300042624 Bacteria 2819
20 Ga0466702_376733 3300042635 Bacteria 2837
21 Ga0466703_010429 3300042636 Bacteria 3811
22 Ga0466703_190177 3300042636 Bacteria 7436
23 Ga0466704_165389 3300042643 Bacteria 2616
24 Ga0466704_332760 3300042643 Bacteria 3785
25 Ga0123356_10002007 3300010049 Bacteria 22006
26 Ga0123353_10615697 3300010167 Bacteria 1547
27 Ga0466715_022290 3300042616 Bacteria 17263
28 Ga0466729_141673 3300042621 Unclassified 2879
29 Ga0466717_071525 3300042604 Bacteria 5579
30 Ga0466732_345256 3300042656 Bacteria 21012
31 Ga0466733_079949 3300042659 Bacteria 1604
32 IMNBGM34_c008358 3300000036 Bacteria 1320
33 JGI24698J34947_10096448 3300002449 Bacteria 1341
34 Ga0072941_1244979 3300005201 Bacteria 3858
35 Ga0466705_021817 3300042612 Unclassified 3633
36 Ga0466703_169754 3300042636 Bacteria 3657
37 Ga0466708_240473 3300042652 Bacteria 40706
38 Ga0123353_10000465 3300010167 Bacteria 50606
39 Ga0123353_10193870 3300010167 Bacteria 3204
40 Ga0264413_104235 3300024493 Bacteria 8345
41 Ga0415639_099330 3300038395 Unclassified 6833
42 Ga0466719_076149 3300042606 Bacteria 1379
43 JGI24695J34938_10007804 3300002450 Unclassified 6201
44 JGI24702J35022_10013651 3300002462 Bacteria 4494
45 Ga0466703_035576 3300042636 Bacteria 4274
46 Ga0466703_302512 3300042636 Bacteria 4551
47 Ga0466708_324855 3300042652 Bacteria 19079
48 Ga0123356_10035391 3300010049 Bacteria 4665
49 Ga0123356_11089305 3300010049 Bacteria 967
50 Ga0466696_236304 3300042596 Unclassified 1717
51 Ga0466729_195453 3300042621 Bacteria 3107
52 Ga0466716_170363 3300042605 Bacteria 40132
53 Ga0466716_541566 3300042605 Bacteria 3148
54 Ga0466719_137264 3300042606 Bacteria 3018
55 Ga0466733_177713 3300042659 Bacteria 1304
56 HBC_ctgsDRAFT_1000074 3300000333 Bacteria 25452
57 Ga0466704_207471 3300042643 Bacteria 6110
58 Ga0123356_10323310 3300010049 Unclassified 1656
59 Ga0123356_10976003 3300010049 Bacteria 1018
60 Ga0123353_10000402 3300010167 Bacteria 53324
61 Ga0123353_10386176 3300010167 Bacteria 2091
62 Ga0123353_10548355 3300010167 Archaea 1668
63 Ga0264413_114113 3300024493 Bacteria 3570
64 Ga0466696_017392 3300042596 Bacteria 22055
65 Ga0466711_309815 3300042615 Bacteria 4428
66 Ga0466723_241922 3300042618 Bacteria 16504
67 Ga0466716_176568 3300042605 Bacteria 3728
68 Ga0466716_436626 3300042605 Bacteria 8455
69 Ga0466720_040267 3300042607 Bacteria 18018
70 Ga0466721_264385 3300042608 Bacteria 50662
71 Ga0072941_1020819 3300005201 Bacteria 9707
72 Ga0072941_1083741 3300005201 Unclassified 8042
73 Ga0123357_10000092 3300009784 Bacteria 72696
74 Ga0466703_183339 3300042636 Bacteria 18265
75 Ga0466703_228024 3300042636 Bacteria 7404
76 Ga0123353_10775785 3300010167 Bacteria 1329
77 Ga0415639_052932 3300038395 Bacteria 18692
78 Ga0415639_066254 3300038395 Bacteria 18098
79 Ga0466690_000482 3300042590 Bacteria 12403
80 Ga0466696_360711 3300042596 Bacteria 1231
81 Ga0466718_051053 3300042617 Bacteria 24981
82 Ga0466726_229950 3300042619 Bacteria 2984
83 AustNasuHG_c1000221 3300000089 Bacteria 19027
84 JGI24695J34938_10000973 3300002450 Bacteria 26120
85 Ga0466705_145493 3300042612 Unclassified 1719
86 Ga0123356_10000600 3300010049 Bacteria 39797
87 Ga0123356_10003908 3300010049 Bacteria 15524
88 Ga0123356_10320583 3300010049 Bacteria 1663
89 Ga0123353_10004288 3300010167 Bacteria 18329
90 Ga0123353_10401035 3300010167 Bacteria 2041
91 Ga0415639_171092 3300038395 Bacteria 3795
92 Ga0466690_020913 3300042590 Bacteria 19193
93 Ga0466691_117936 3300042593 Bacteria 98351
94 Ga0466696_030833 3300042596 Bacteria 17732
95 Ga0466696_123822 3300042596 Unclassified 1551
96 Ga0466716_063724 3300042605 Bacteria 141162
97 Ga0466716_071130 3300042605 Bacteria 30025
98 Ga0466720_064529 3300042607 Bacteria 17314
99 Nasutiter_Contig19037 2030936001 Bacteria 3871
100 Ga0072940_1112888 3300005200 Bacteria 6164
101 Ga0466703_396800 3300042636 Bacteria 8616
102 Ga0466704_599167 3300042643 Bacteria 2272
103 Ga0466708_084655 3300042652 Bacteria 2288
104 Ga0123353_10505884 3300010167 Bacteria 1758
105 Ga0466657_182735 3300042582 Bacteria 91898
106 Ga0466696_251634 3300042596 Bacteria 3631
107 Ga0466696_283684 3300042596 Bacteria 52815
108 Ga0466711_245274 3300042615 Bacteria 50753
109 Ga0466711_514269 3300042615 Unclassified 1598
110 Ga0466718_139375 3300042617 Bacteria 1399
111 Ga0466723_094701 3300042618 Bacteria 16728
112 Ga0466719_531866 3300042606 Bacteria 24229
113 Ga0466720_159683 3300042607 Unclassified 18768
114 Ga0466698_411189 3300042610 Bacteria 1106

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01882 DUF58 Protein of unknown function DUF58 38 122 0.96
PF13519 VWA_2 von Willebrand factor type A domain 80 184 0.91
PF05762 VWA_CoxE VWA domain containing CoxE-like protein 53 204 0.67

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.