Protein Family IF06372

Metagenome Isolate
109 Members
27 Samples
107 Scaffolds
458.69 Avg Length

🧬 Representative Sequence

ID
3300042605|Ga0466716_241314|Ga0466716_241314_1328_2812
Length
494 aa
Sequence
MAAGGSVSERMNIVITGHVDHGKSTLVGRLLADTASLPQGKLQAVKDSCKKNGRVFEYAFLLDALEDEQKQGITIDSARIFFKSALREYLIIDAPGHIEFLRNMLSGASRAVAAVLVIDAVEGVAENSKRHGLLLSLLGISQVLVAVNKLDALDYDEGVFERIKREYGAYLETLKVKPLAFVPVSAREGKNITEGAPAEMPWYRGKTVLEVLDSFYNPSSSGDSPDFRAAFAMPVQDVYRFSNDNDDRRIYAGTVVGGGVSVGDAVSFLPSRKEARIKSIEVWAAPVKTRAVAGEASGFTLEEEIYVKRGEVMXXXXEASPVRAAARLRANVIGLGSRPLGYDRAYLLQLGSEKVVARLEKIARFLGEGGGGGYRELRRHDCGSVILRLARPVAVSSFYENASLGRFVIVDGYDAAGGGIVLESLEPGDEAPDRPRISKDFEEELFAFLKVHFPHRFVNSGRQEGGDLQGLVADEGTALPGGRSVLVKNELCIL

📊 Sample Types

Isolate 1.8%
Metagenome 98.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 53.8%
Termopsidae 15.4%
Rhinotermitidae 11.5%
Unclassified 11.5%
Termitidae 7.7%

🌳 Taxonomy

Archaea 4
Bacteria 103
Eukaryota 0
Viruses 0
Unclassified 2

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
2 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
7 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
8 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
9 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
10 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
11 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
12 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
13 650716102 Treponema primitia ZAS-2 Isolate Unclassified
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
16 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
17 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
21 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
22 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
23 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466693_146140 3300042592 Bacteria 12529
2 Ga0466723_236078 3300042618 Bacteria 3205
3 Ga0466726_041189 3300042619 Bacteria 4314
4 Ga0466726_156790 3300042619 Archaea 1960
5 Ga0466709_232251 3300042648 Bacteria 10786
6 Ga0466709_409102 3300042648 Bacteria 9803
7 Ga0466716_241314 3300042605 Bacteria 2989
8 Ga0466719_284700 3300042606 Bacteria 3222
9 Ga0466690_019163 3300042590 Bacteria 10570
10 Ga0466690_308914 3300042590 Unclassified 2609
11 Ga0466692_029401 3300042591 Bacteria 33046
12 Ga0466692_033490 3300042591 Bacteria 25185
13 Ga0466696_174001 3300042596 Bacteria 7832
14 Ga0466715_010529 3300042616 Bacteria 11517
15 Ga0466715_400899 3300042616 Bacteria 13959
16 Ga0466726_244232 3300042619 Bacteria 1966
17 Ga0466728_340171 3300042620 Bacteria 2901
18 Ga0072941_1360386 3300005201 Bacteria 4597
19 Ga0466704_334574 3300042643 Bacteria 23261
20 Ga0466708_046327 3300042652 Bacteria 4082
21 Ga0466708_290635 3300042652 Bacteria 2508
22 Ga0466719_241021 3300042606 Bacteria 3605
23 Ga0466692_200729 3300042591 Bacteria 3701
24 Ga0466691_223202 3300042593 Bacteria 7345
25 Ga0466715_638964 3300042616 Bacteria 19632
26 Ga0466726_068780 3300042619 Bacteria 5483
27 Ga0466726_214212 3300042619 Bacteria 5408
28 Ga0466705_218523 3300042612 Bacteria 1794
29 Ga0466705_258527 3300042612 Bacteria 24461
30 Ga0466703_081382 3300042636 Bacteria 31925
31 Ga0466703_363573 3300042636 Bacteria 15833
32 Ga0466727_031161 3300042655 Bacteria 16734
33 Ga0466727_134103 3300042655 Archaea 1702
34 Ga0466727_247803 3300042655 Archaea 2824
35 Ga0466707_080214 3300042601 Bacteria 6726
36 Ga0466719_427473 3300042606 Unclassified 4867
37 Ga0466691_084551 3300042593 Bacteria 7375
38 Ga0466691_218088 3300042593 Bacteria 72508
39 Ga0466696_279698 3300042596 Bacteria 20837
40 Ga0466696_465148 3300042596 Bacteria 18876
41 Ga0466711_208023 3300042615 Bacteria 35608
42 Ga0466711_256242 3300042615 Bacteria 13056
43 Ga0466715_214788 3300042616 Bacteria 20312
44 Ga0466703_321940 3300042636 Bacteria 6714
45 Ga0466704_082232 3300042643 Bacteria 10621
46 Ga0466704_215410 3300042643 Bacteria 21040
47 Ga0466709_063972 3300042648 Bacteria 3954
48 Ga0466709_178089 3300042648 Bacteria 4504
49 Ga0466708_359657 3300042652 Bacteria 31241
50 Ga0466708_426473 3300042652 Bacteria 14533
51 Ga0466716_114098 3300042605 Bacteria 9273
52 Ga0466722_065265 3300042609 Bacteria 4819
53 Ga0466711_019938 3300042615 Bacteria 5167
54 Ga0466715_459988 3300042616 Bacteria 8535
55 Ga0466723_027032 3300042618 Bacteria 3276
56 Ga0466723_109317 3300042618 Bacteria 17545
57 Ga0466728_436174 3300042620 Bacteria 8711
58 Ga0466732_172475 3300042656 Bacteria 59923
59 Ga0466704_159676 3300042643 Bacteria 18888
60 Ga0466704_392542 3300042643 Bacteria 6038
61 Ga0466709_215478 3300042648 Bacteria 19677
62 Ga0466727_279533 3300042655 Bacteria 6568
63 Ga0466707_050695 3300042601 Bacteria 2439
64 Ga0466719_151223 3300042606 Bacteria 8048
65 Ga0466719_297172 3300042606 Bacteria 8181
66 Ga0466719_321917 3300042606 Bacteria 6302
67 Ga0466690_262373 3300042590 Bacteria 1956
68 Ga0466692_074566 3300042591 Bacteria 31676
69 Ga0466705_425901 3300042612 Bacteria 2486
70 Ga0466723_015261 3300042618 Bacteria 2067
71 Ga0466723_343653 3300042618 Bacteria 7607
72 Ga0466728_162855 3300042620 Bacteria 8346
73 Ga0068302_10015348 3300005071 Bacteria 8079
74 Ga0466735_071002 3300042624 Bacteria 3629
75 Ga0466727_017937 3300042655 Bacteria 3226
76 Ga0466727_074384 3300042655 Bacteria 6541
77 Ga0466716_137730 3300042605 Bacteria 9801
78 Ga0466716_248116 3300042605 Bacteria 2006
79 Ga0466690_045720 3300042590 Bacteria 10753
80 Ga0466692_063408 3300042591 Bacteria 5579
81 Ga0466715_130130 3300042616 Bacteria 3919
82 Ga0466726_102305 3300042619 Bacteria 7007
83 Ga0466726_318235 3300042619 Bacteria 1422
84 Ga0466728_255445 3300042620 Bacteria 2117
85 Ga0466728_366055 3300042620 Bacteria 2659
86 Ga0466729_138359 3300042621 Bacteria 3043
87 Ga0466705_039051 3300042612 Bacteria 14303
88 Ga0466735_173492 3300042624 Archaea 3316
89 Ga0466703_040076 3300042636 Bacteria 10603
90 Ga0466703_226820 3300042636 Bacteria 4626
91 Ga0466708_175575 3300042652 Bacteria 9563
92 Ga0466727_015712 3300042655 Bacteria 5811
93 Ga0466719_042957 3300042606 Bacteria 11596
94 Ga0466719_080366 3300042606 Bacteria 6022
95 Ga0466722_004140 3300042609 Bacteria 2709
96 Ga0466691_221593 3300042593 Bacteria 3498
97 Ga0466715_609945 3300042616 Bacteria 50733
98 Ga0466726_117645 3300042619 Bacteria 3723
99 Ga0466726_211494 3300042619 Bacteria 13502
100 Ga0466726_325320 3300042619 Bacteria 1619
101 Ga0466705_014879 3300042612 Bacteria 2683
102 Ga0072941_1204108 3300005201 Bacteria 6466
103 Ga0466735_192157 3300042624 Bacteria 3984
104 Ga0466703_206915 3300042636 Bacteria 8728
105 Ga0466704_023869 3300042643 Bacteria 9255
106 Ga0466719_022407 3300042606 Bacteria 9858
107 Ga0466722_045940 3300042609 Bacteria 10911

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF22594 GTP-eEF1A_C GTP-eEF1A C-terminal domain-like 328 421 0.92
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 10 215 0.88

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.