Protein Family IF06316
Metagenome
Metatranscriptome
Isolate
150
Members
36
Samples
147
Scaffolds
314.71
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_064686|Ga0466716_064686_131_1213
- Length
- 360 aa
- Sequence
- LTGSSVKNSVVWERQFPNNFNRQIDPLLRIKKYAGGKDKMKKIVLLAVLIIAIVGVLPVFAGPGGQQGGKIKAIFIAMDSQDEHWQKVKAGTEAKAKELGNIDLTFNAPPTKLDSVTQLQMVEDAITKKVDILMVAPLNADAIVPAVEKAKKAGITVIIIDSAANTNVYDSFLSTDSVAAGAMAADKLAEAIGGRGKIAIINHQAGAGTTLARQSGFENQVKAKYPNITIVGTQYSDGDKTKALNLATDFMTANPDLAGIYATNEGSTIGAGNGIIQAGKAGRVKFVGFDWSADTKSLIEQDVLYATMVQNPFVMGYEGLQTGVDVYNKKSVQKQIDTGVTVANKTNAAQIDALAWGGTR
Sample Types
Isolate
1.3%
Metagenome
98.0%
MAG
0.0%
Metatranscriptome
0.7%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
40.0%
Termitidae
34.3%
Unclassified
11.4%
Termopsidae
8.6%
Rhinotermitidae
5.7%
Taxonomy
Archaea
0
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 13 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 14 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 15 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 18 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 21 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 22 | 3300022820 | Termite gut microbial communities from Nasutitermes sp. nest - French Guiana - 36-11 mRNA | Metatranscriptome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_131407 | 3300042659 | Bacteria | 53727 |
| 2 | Ga0072941_1033655 | 3300005201 | Bacteria | 4055 |
| 3 | Ga0466690_033721 | 3300042590 | Bacteria | 2940 |
| 4 | Ga0466690_125148 | 3300042590 | Bacteria | 2052 |
| 5 | Ga0466690_130145 | 3300042590 | Bacteria | 8437 |
| 6 | Ga0466692_054137 | 3300042591 | Bacteria | 2179 |
| 7 | Ga0466691_002400 | 3300042593 | Bacteria | 9093 |
| 8 | Ga0466691_073118 | 3300042593 | Bacteria | 13798 |
| 9 | Ga0466696_030737 | 3300042596 | Bacteria | 4253 |
| 10 | Ga0466711_230210 | 3300042615 | Bacteria | 17782 |
| 11 | Ga0466723_260846 | 3300042618 | Bacteria | 3845 |
| 12 | Ga0466726_376768 | 3300042619 | Bacteria | 6329 |
| 13 | Ga0466726_457871 | 3300042619 | Unclassified | 2534 |
| 14 | Ga0466728_207555 | 3300042620 | Bacteria | 2334 |
| 15 | Ga0466716_361425 | 3300042605 | Bacteria | 5717 |
| 16 | Ga0466716_545727 | 3300042605 | Bacteria | 7260 |
| 17 | Ga0466719_120477 | 3300042606 | Unclassified | 4980 |
| 18 | Ga0466719_167092 | 3300042606 | Bacteria | 8693 |
| 19 | Ga0466722_108535 | 3300042609 | Bacteria | 33816 |
| 20 | Ga0466703_045362 | 3300042636 | Unclassified | 2918 |
| 21 | Ga0466704_055514 | 3300042643 | Unclassified | 3331 |
| 22 | Ga0466704_331502 | 3300042643 | Bacteria | 21955 |
| 23 | Ga0466704_421899 | 3300042643 | Unclassified | 4573 |
| 24 | Ga0466704_560874 | 3300042643 | Bacteria | 79195 |
| 25 | Ga0466709_376763 | 3300042648 | Unclassified | 1562 |
| 26 | Ga0466708_169238 | 3300042652 | Bacteria | 7637 |
| 27 | Ga0466708_236064 | 3300042652 | Bacteria | 6317 |
| 28 | Ga0466708_260331 | 3300042652 | Bacteria | 1816 |
| 29 | Ga0466727_318883 | 3300042655 | Bacteria | 4411 |
| 30 | Ga0466705_345100 | 3300042612 | Bacteria | 18869 |
| 31 | Ga0466690_119542 | 3300042590 | Bacteria | 13932 |
| 32 | Ga0466691_142326 | 3300042593 | Bacteria | 6310 |
| 33 | Ga0466691_210841 | 3300042593 | Bacteria | 4011 |
| 34 | Ga0466694_253699 | 3300042594 | Bacteria | 1531 |
| 35 | Ga0466696_309776 | 3300042596 | Bacteria | 17097 |
| 36 | Ga0466711_107028 | 3300042615 | Bacteria | 2754 |
| 37 | Ga0466728_037276 | 3300042620 | Bacteria | 24162 |
| 38 | Ga0123357_10185253 | 3300009784 | Bacteria | 2417 |
| 39 | Ga0466700_169087 | 3300042600 | Bacteria | 1355 |
| 40 | Ga0466722_138857 | 3300042609 | Bacteria | 7375 |
| 41 | Ga0466698_085802 | 3300042610 | Bacteria | 1550 |
| 42 | Ga0466709_012340 | 3300042648 | Bacteria | 19014 |
| 43 | Ga0466709_148056 | 3300042648 | Bacteria | 27802 |
| 44 | Ga0466708_076259 | 3300042652 | Bacteria | 15903 |
| 45 | Ga0466708_390509 | 3300042652 | Bacteria | 33782 |
| 46 | Ga0068305_10914325 | 3300005083 | Bacteria | 2910 |
| 47 | Ga0466690_008623 | 3300042590 | Bacteria | 5578 |
| 48 | Ga0466691_023813 | 3300042593 | Bacteria | 9111 |
| 49 | Ga0466694_198946 | 3300042594 | Bacteria | 14685 |
| 50 | Ga0466696_076554 | 3300042596 | Bacteria | 14573 |
| 51 | Ga0466723_253111 | 3300042618 | Bacteria | 23254 |
| 52 | Ga0466728_170827 | 3300042620 | Bacteria | 3549 |
| 53 | Ga0466735_045423 | 3300042624 | Bacteria | 2013 |
| 54 | Ga0466703_011229 | 3300042636 | Bacteria | 8838 |
| 55 | Ga0466705_031741 | 3300042612 | Bacteria | 8414 |
| 56 | Ga0466690_134139 | 3300042590 | Bacteria | 10740 |
| 57 | Ga0466691_011834 | 3300042593 | Bacteria | 4197 |
| 58 | Ga0466699_180638 | 3300042597 | Bacteria | 1038 |
| 59 | Ga0466715_198779 | 3300042616 | Bacteria | 8994 |
| 60 | Ga0466723_005829 | 3300042618 | Bacteria | 4705 |
| 61 | Ga0466723_197005 | 3300042618 | Bacteria | 9654 |
| 62 | Ga0466726_096939 | 3300042619 | Bacteria | 2679 |
| 63 | Ga0466726_143184 | 3300042619 | Bacteria | 21443 |
| 64 | Ga0466726_286863 | 3300042619 | Bacteria | 6315 |
| 65 | Ga0466726_451120 | 3300042619 | Bacteria | 1510 |
| 66 | Ga0466722_041426 | 3300042609 | Bacteria | 3392 |
| 67 | Ga0466703_300587 | 3300042636 | Bacteria | 3931 |
| 68 | Ga0466704_107036 | 3300042643 | Bacteria | 9789 |
| 69 | Ga0466708_034429 | 3300042652 | Bacteria | 7237 |
| 70 | Ga0466708_058990 | 3300042652 | Bacteria | 9715 |
| 71 | Ga0466708_138557 | 3300042652 | Bacteria | 28114 |
| 72 | Ga0466708_169403 | 3300042652 | Bacteria | 2343 |
| 73 | Ga0466708_319047 | 3300042652 | Bacteria | 8435 |
| 74 | Ga0466733_203607 | 3300042659 | Bacteria | 46881 |
| 75 | Ga0255809_1003372 | 3300022820 | Bacteria | 2089 |
| 76 | Ga0466690_303539 | 3300042590 | Bacteria | 6935 |
| 77 | Ga0466692_172870 | 3300042591 | Bacteria | 5864 |
| 78 | Ga0466691_069378 | 3300042593 | Bacteria | 11912 |
| 79 | Ga0466691_086423 | 3300042593 | Bacteria | 57002 |
| 80 | Ga0466694_030552 | 3300042594 | Bacteria | 2556 |
| 81 | Ga0466696_191503 | 3300042596 | Bacteria | 28288 |
| 82 | Ga0466711_141893 | 3300042615 | Bacteria | 20863 |
| 83 | Ga0466723_260032 | 3300042618 | Unclassified | 5777 |
| 84 | Ga0466726_338431 | 3300042619 | Bacteria | 3133 |
| 85 | Ga0466728_018642 | 3300042620 | Bacteria | 2757 |
| 86 | Ga0466728_416476 | 3300042620 | Bacteria | 1483 |
| 87 | Ga0466716_041906 | 3300042605 | Bacteria | 8129 |
| 88 | Ga0466719_198004 | 3300042606 | Bacteria | 3933 |
| 89 | Ga0466703_205852 | 3300042636 | Bacteria | 6001 |
| 90 | Ga0466708_325768 | 3300042652 | Bacteria | 11266 |
| 91 | Ga0466727_117751 | 3300042655 | Bacteria | 26630 |
| 92 | Ga0466705_120732 | 3300042612 | Bacteria | 3112 |
| 93 | AustNasuHG_c1003745 | 3300000089 | Bacteria | 5486 |
| 94 | AustNasuHG_c1014493 | 3300000089 | Bacteria | 2678 |
| 95 | Ga0466690_011182 | 3300042590 | Unclassified | 3851 |
| 96 | Ga0466690_089755 | 3300042590 | Bacteria | 6332 |
| 97 | Ga0466690_133147 | 3300042590 | Bacteria | 3703 |
| 98 | Ga0466692_081268 | 3300042591 | Bacteria | 3156 |
| 99 | Ga0466691_120098 | 3300042593 | Bacteria | 1763 |
| 100 | Ga0466691_183009 | 3300042593 | Unclassified | 2508 |
| 101 | Ga0466694_029796 | 3300042594 | Bacteria | 11512 |
| 102 | Ga0466696_086049 | 3300042596 | Unclassified | 3601 |
| 103 | Ga0466726_095458 | 3300042619 | Bacteria | 1928 |
| 104 | Ga0466728_410391 | 3300042620 | Bacteria | 1383 |
| 105 | Ga0466716_026302 | 3300042605 | Bacteria | 9421 |
| 106 | Ga0466716_064686 | 3300042605 | Bacteria | 1275 |
| 107 | Ga0466716_326503 | 3300042605 | Bacteria | 28464 |
| 108 | Ga0466735_036070 | 3300042624 | Bacteria | 6552 |
| 109 | Ga0466704_276344 | 3300042643 | Bacteria | 24989 |
| 110 | Ga0466709_075663 | 3300042648 | Bacteria | 4141 |
| 111 | Ga0466708_209260 | 3300042652 | Bacteria | 6316 |
| 112 | Ga0466733_174845 | 3300042659 | Bacteria | 59283 |
| 113 | Ga0466733_213369 | 3300042659 | Bacteria | 1781 |
| 114 | Ga0466705_421207 | 3300042612 | Bacteria | 4143 |
| 115 | Ga0466711_079951 | 3300042615 | Bacteria | 16560 |
| 116 | Ga0466715_179160 | 3300042616 | Bacteria | 14823 |
| 117 | Ga0466723_178773 | 3300042618 | Bacteria | 30734 |
| 118 | Ga0466728_249690 | 3300042620 | Bacteria | 21893 |
| 119 | Ga0466728_310183 | 3300042620 | Bacteria | 3275 |
| 120 | Ga0123353_10232732 | 3300010167 | Bacteria | 2871 |
| 121 | Ga0466707_258729 | 3300042601 | Bacteria | 2260 |
| 122 | Ga0466719_093450 | 3300042606 | Bacteria | 19978 |
| 123 | Ga0466703_270036 | 3300042636 | Bacteria | 60178 |
| 124 | Ga0466704_065287 | 3300042643 | Bacteria | 17940 |
| 125 | Ga0466709_023876 | 3300042648 | Bacteria | 13159 |
| 126 | Ga0466708_039885 | 3300042652 | Unclassified | 2377 |
| 127 | Ga0466708_139430 | 3300042652 | Bacteria | 31102 |
| 128 | Ga0466732_435443 | 3300042656 | Bacteria | 1634 |
| 129 | JGI24702J35022_10018263 | 3300002462 | Bacteria | 3826 |
| 130 | Ga0466691_051874 | 3300042593 | Bacteria | 2050 |
| 131 | Ga0466695_167857 | 3300042595 | Bacteria | 5695 |
| 132 | Ga0466705_500622 | 3300042612 | Bacteria | 12523 |
| 133 | Ga0466711_316978 | 3300042615 | Bacteria | 8536 |
| 134 | Ga0466715_109137 | 3300042616 | Bacteria | 11299 |
| 135 | Ga0466723_086116 | 3300042618 | Bacteria | 8843 |
| 136 | Ga0466726_146284 | 3300042619 | Bacteria | 2129 |
| 137 | Ga0123357_10275619 | 3300009784 | Bacteria | 1748 |
| 138 | Ga0466722_001022 | 3300042609 | Bacteria | 4457 |
| 139 | Ga0466722_115474 | 3300042609 | Bacteria | 4813 |
| 140 | Ga0466698_018389 | 3300042610 | Bacteria | 3912 |
| 141 | Ga0466735_156344 | 3300042624 | Bacteria | 4465 |
| 142 | Ga0466703_091816 | 3300042636 | Bacteria | 8919 |
| 143 | Ga0466703_282846 | 3300042636 | Bacteria | 2018 |
| 144 | Ga0466704_468165 | 3300042643 | Bacteria | 19033 |
| 145 | Ga0466708_372822 | 3300042652 | Unclassified | 2000 |
| 146 | Ga0466727_196413 | 3300042655 | Unclassified | 3875 |
| 147 | Ga0466727_299487 | 3300042655 | Unclassified | 3814 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.