Protein Family IF06037
Metagenome
140
Members
29
Samples
140
Scaffolds
161.11
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_022818|Ga0466713_022818_4122_4703
- Length
- 193 aa
- Sequence
- VNFEDFFAIYHKCGIAGRGNNPYLCSKKSLNMAEESNVKKLSIIAFSGDFDKLTAVFTLATGAAAVGYEVNLFFTFWGLDAIKKKLGRSPVGKGFLPKVFGVFMGGLKASPVSRLNFAGISPKIFRYLMRKNNVATLEELVEAAKLLGINFYACEMAMHVLGLSKDDFIPEVKDVLGVASFLKLSEGGQTLFI
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
50.0%
Termopsidae
14.3%
Termitidae
14.3%
Rhinotermitidae
10.7%
Unclassified
10.7%
Taxonomy
Archaea
0
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 2 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 3 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 4 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 5 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 6 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 10 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 11 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 19 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 20 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 24 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 25 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 26 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 27 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 28 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0068305_10009904 | 3300005083 | Bacteria | 41398 |
| 2 | Ga0072941_1129562 | 3300005201 | Bacteria | 1162 |
| 3 | Ga0466712_034000 | 3300042614 | Bacteria | 2407 |
| 4 | Ga0466711_120016 | 3300042615 | Bacteria | 45710 |
| 5 | Ga0466711_441474 | 3300042615 | Bacteria | 2378 |
| 6 | Ga0466715_220985 | 3300042616 | Bacteria | 5167 |
| 7 | Ga0466715_284344 | 3300042616 | Bacteria | 1215 |
| 8 | Ga0466723_211370 | 3300042618 | Unclassified | 7595 |
| 9 | Ga0466726_039577 | 3300042619 | Bacteria | 9206 |
| 10 | Ga0466726_178762 | 3300042619 | Bacteria | 3163 |
| 11 | Ga0466726_304566 | 3300042619 | Bacteria | 1282 |
| 12 | Ga0466728_251250 | 3300042620 | Bacteria | 3083 |
| 13 | Ga0466691_066350 | 3300042593 | Bacteria | 1582 |
| 14 | Ga0466707_250758 | 3300042601 | Bacteria | 5499 |
| 15 | Ga0466707_282392 | 3300042601 | Bacteria | 5252 |
| 16 | Ga0466716_497087 | 3300042605 | Bacteria | 1125 |
| 17 | Ga0466719_137707 | 3300042606 | Bacteria | 2410 |
| 18 | Ga0466722_052005 | 3300042609 | Bacteria | 18786 |
| 19 | Ga0466722_081503 | 3300042609 | Bacteria | 8422 |
| 20 | Ga0466727_317616 | 3300042655 | Bacteria | 3585 |
| 21 | Ga0068302_10204387 | 3300005071 | Bacteria | 858 |
| 22 | Ga0466715_118812 | 3300042616 | Bacteria | 9918 |
| 23 | Ga0466729_097845 | 3300042621 | Bacteria | 1943 |
| 24 | Ga0466690_000525 | 3300042590 | Bacteria | 32328 |
| 25 | Ga0466690_036111 | 3300042590 | Bacteria | 4718 |
| 26 | Ga0466690_292437 | 3300042590 | Unclassified | 1429 |
| 27 | Ga0466691_099253 | 3300042593 | Bacteria | 5979 |
| 28 | Ga0466707_155945 | 3300042601 | Bacteria | 1678 |
| 29 | Ga0466707_223608 | 3300042601 | Bacteria | 2168 |
| 30 | Ga0466719_024070 | 3300042606 | Unclassified | 1674 |
| 31 | Ga0466719_044618 | 3300042606 | Unclassified | 1127 |
| 32 | Ga0466705_092601 | 3300042612 | Bacteria | 6138 |
| 33 | Ga0466703_432101 | 3300042636 | Bacteria | 7203 |
| 34 | Ga0466709_281639 | 3300042648 | Bacteria | 14893 |
| 35 | Ga0466708_251055 | 3300042652 | Bacteria | 27047 |
| 36 | JGI24699J35502_11113421 | 3300002509 | Bacteria | 2809 |
| 37 | Ga0068305_10005212 | 3300005083 | Unclassified | 2998 |
| 38 | Ga0466723_248159 | 3300042618 | Bacteria | 8569 |
| 39 | Ga0466690_258137 | 3300042590 | Bacteria | 21952 |
| 40 | Ga0466692_119070 | 3300042591 | Bacteria | 9793 |
| 41 | Ga0466693_124963 | 3300042592 | Unclassified | 3356 |
| 42 | Ga0466696_366586 | 3300042596 | Bacteria | 1297 |
| 43 | Ga0466707_063434 | 3300042601 | Bacteria | 6335 |
| 44 | Ga0466713_101607 | 3300042602 | Bacteria | 3015 |
| 45 | Ga0466713_103435 | 3300042602 | Bacteria | 10777 |
| 46 | Ga0466716_129527 | 3300042605 | Bacteria | 6416 |
| 47 | Ga0466719_062002 | 3300042606 | Bacteria | 2903 |
| 48 | Ga0466719_276804 | 3300042606 | Bacteria | 11951 |
| 49 | Ga0466719_299626 | 3300042606 | Bacteria | 4979 |
| 50 | Ga0466719_448914 | 3300042606 | Bacteria | 5969 |
| 51 | Ga0466722_049867 | 3300042609 | Bacteria | 2355 |
| 52 | Ga0466703_103103 | 3300042636 | Bacteria | 12687 |
| 53 | Ga0466703_158127 | 3300042636 | Bacteria | 9098 |
| 54 | Ga0068302_10345858 | 3300005071 | Bacteria | 1150 |
| 55 | Ga0466712_262619 | 3300042614 | Bacteria | 2611 |
| 56 | Ga0466711_104770 | 3300042615 | Bacteria | 15623 |
| 57 | Ga0466711_461515 | 3300042615 | Bacteria | 10621 |
| 58 | Ga0466715_069909 | 3300042616 | Bacteria | 7851 |
| 59 | Ga0466715_636818 | 3300042616 | Bacteria | 23439 |
| 60 | Ga0466726_035201 | 3300042619 | Bacteria | 8982 |
| 61 | Ga0466728_057163 | 3300042620 | Bacteria | 8959 |
| 62 | Ga0466690_378263 | 3300042590 | Bacteria | 22561 |
| 63 | Ga0466692_014559 | 3300042591 | Unclassified | 2500 |
| 64 | Ga0466691_089012 | 3300042593 | Bacteria | 15745 |
| 65 | Ga0466713_022818 | 3300042602 | Bacteria | 11672 |
| 66 | Ga0466713_085588 | 3300042602 | Bacteria | 13401 |
| 67 | Ga0466716_133589 | 3300042605 | Bacteria | 12945 |
| 68 | Ga0466703_425022 | 3300042636 | Bacteria | 3228 |
| 69 | Ga0466704_279867 | 3300042643 | Bacteria | 7231 |
| 70 | Ga0466709_069750 | 3300042648 | Bacteria | 17091 |
| 71 | Ga0466709_073819 | 3300042648 | Bacteria | 8410 |
| 72 | Ga0466727_098951 | 3300042655 | Bacteria | 1351 |
| 73 | Ga0466727_251981 | 3300042655 | Bacteria | 8705 |
| 74 | Ga0466711_027530 | 3300042615 | Bacteria | 8952 |
| 75 | Ga0466711_036443 | 3300042615 | Unclassified | 3226 |
| 76 | Ga0466723_116272 | 3300042618 | Bacteria | 5344 |
| 77 | Ga0466723_218926 | 3300042618 | Unclassified | 2555 |
| 78 | Ga0466726_380971 | 3300042619 | Bacteria | 2238 |
| 79 | Ga0466728_329152 | 3300042620 | Bacteria | 13258 |
| 80 | Ga0466707_013194 | 3300042601 | Bacteria | 2547 |
| 81 | Ga0466722_111075 | 3300042609 | Bacteria | 2397 |
| 82 | Ga0466735_031742 | 3300042624 | Bacteria | 1023 |
| 83 | Ga0466735_032165 | 3300042624 | Bacteria | 5096 |
| 84 | Ga0466735_114930 | 3300042624 | Bacteria | 5798 |
| 85 | Ga0466735_119090 | 3300042624 | Unclassified | 1151 |
| 86 | JGI24699J35502_10751955 | 3300002509 | Bacteria | 820 |
| 87 | Ga0466715_189721 | 3300042616 | Bacteria | 14393 |
| 88 | Ga0466715_210105 | 3300042616 | Bacteria | 6009 |
| 89 | Ga0466715_279345 | 3300042616 | Bacteria | 13107 |
| 90 | Ga0466715_354990 | 3300042616 | Bacteria | 2994 |
| 91 | Ga0466726_125202 | 3300042619 | Bacteria | 1898 |
| 92 | Ga0466726_204881 | 3300042619 | Bacteria | 5967 |
| 93 | Ga0466728_212226 | 3300042620 | Bacteria | 1101 |
| 94 | Ga0466692_012407 | 3300042591 | Bacteria | 2394 |
| 95 | Ga0466692_050107 | 3300042591 | Bacteria | 1181 |
| 96 | Ga0466692_077706 | 3300042591 | Unclassified | 5118 |
| 97 | Ga0466691_036493 | 3300042593 | Bacteria | 13583 |
| 98 | Ga0466707_124419 | 3300042601 | Bacteria | 18062 |
| 99 | Ga0466707_348434 | 3300042601 | Bacteria | 30347 |
| 100 | Ga0466713_028181 | 3300042602 | Unclassified | 5909 |
| 101 | Ga0466716_111902 | 3300042605 | Bacteria | 19578 |
| 102 | Ga0466719_070040 | 3300042606 | Bacteria | 10447 |
| 103 | Ga0466719_109950 | 3300042606 | Bacteria | 5725 |
| 104 | Ga0466722_207050 | 3300042609 | Bacteria | 15307 |
| 105 | Ga0466705_016709 | 3300042612 | Bacteria | 4832 |
| 106 | Ga0466705_037971 | 3300042612 | Bacteria | 10937 |
| 107 | Ga0466705_258248 | 3300042612 | Bacteria | 7167 |
| 108 | Ga0466704_200046 | 3300042643 | Bacteria | 8189 |
| 109 | Ga0466704_404430 | 3300042643 | Bacteria | 8302 |
| 110 | Ga0466708_248043 | 3300042652 | Bacteria | 6253 |
| 111 | Ga0466727_258979 | 3300042655 | Bacteria | 1320 |
| 112 | Ga0466727_262228 | 3300042655 | Bacteria | 1594 |
| 113 | Ga0466732_028661 | 3300042656 | Bacteria | 90899 |
| 114 | Ga0466711_226717 | 3300042615 | Bacteria | 7046 |
| 115 | Ga0466711_333090 | 3300042615 | Bacteria | 7667 |
| 116 | Ga0466711_484067 | 3300042615 | Bacteria | 2475 |
| 117 | Ga0466715_518763 | 3300042616 | Bacteria | 23012 |
| 118 | Ga0466726_304398 | 3300042619 | Bacteria | 4346 |
| 119 | Ga0466726_364469 | 3300042619 | Bacteria | 1566 |
| 120 | Ga0466713_124834 | 3300042602 | Bacteria | 50546 |
| 121 | Ga0466716_052738 | 3300042605 | Unclassified | 7079 |
| 122 | Ga0466722_070624 | 3300042609 | Bacteria | 3883 |
| 123 | Ga0466703_355884 | 3300042636 | Bacteria | 17307 |
| 124 | Ga0466727_081347 | 3300042655 | Bacteria | 65648 |
| 125 | Ga0466727_337629 | 3300042655 | Unclassified | 3983 |
| 126 | Ga0068305_10019180 | 3300005083 | Bacteria | 12367 |
| 127 | Ga0466711_052010 | 3300042615 | Bacteria | 10226 |
| 128 | Ga0466715_057348 | 3300042616 | Bacteria | 36717 |
| 129 | Ga0466715_646578 | 3300042616 | Bacteria | 18752 |
| 130 | Ga0466723_254019 | 3300042618 | Bacteria | 22293 |
| 131 | Ga0466723_317063 | 3300042618 | Bacteria | 20196 |
| 132 | Ga0466728_139777 | 3300042620 | Bacteria | 9799 |
| 133 | Ga0466691_202775 | 3300042593 | Bacteria | 12228 |
| 134 | Ga0466696_296312 | 3300042596 | Bacteria | 7935 |
| 135 | Ga0466713_112236 | 3300042602 | Bacteria | 47338 |
| 136 | Ga0466719_033013 | 3300042606 | Bacteria | 9653 |
| 137 | Ga0466704_308354 | 3300042643 | Bacteria | 4287 |
| 138 | Ga0466704_497510 | 3300042643 | Bacteria | 27766 |
| 139 | Ga0466704_527636 | 3300042643 | Bacteria | 2704 |
| 140 | Ga0466708_047749 | 3300042652 | Bacteria | 4355 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13686 | DrsE_2 | DsrE/DsrF/DrsH-like family | 39 | 185 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.