Protein Family IF05923
Metagenome
Isolate
140
Members
42
Samples
134
Scaffolds
247.86
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_256033|Ga0466707_256033_372_1136
- Length
- 254 aa
- Sequence
- MKLLLILGSDDTYELLSLYIRPLGFSLIRYRHVIKAMDNIDEADPAAIIISARDFPRHWKALVQFVRSERSKEACPIIILQGETLPPEISTQAVYLGVNGIVDETLNTSELDRLQSILSRYIPVNEKRRARRFPAADWNRFGLLLENPIDKTLISGEVKTISHTGVSFVPKDPAMMKDITLNTVLNGCSLRAGETILSPICCMVRPGFPVSLEFISFPPDEYKLLQEYLETMPQKELQARLYPWDVHRFKTGTA
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.0%
Termitidae
30.0%
Unclassified
20.0%
Rhinotermitidae
7.5%
Termopsidae
7.5%
Taxonomy
Archaea
0
Bacteria
138
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 4 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 16 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 19 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 20 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 21 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 24 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 25 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 28 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 29 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 30 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 31 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 32 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 37 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_290748 | 3300042612 | Bacteria | 9050 |
| 2 | Ga0466705_371823 | 3300042612 | Bacteria | 1325 |
| 3 | Ga0466715_523869 | 3300042616 | Bacteria | 1834 |
| 4 | Ga0466715_612908 | 3300042616 | Bacteria | 4170 |
| 5 | Ga0466715_620484 | 3300042616 | Bacteria | 3631 |
| 6 | Ga0466718_124315 | 3300042617 | Bacteria | 2121 |
| 7 | Ga0466723_159008 | 3300042618 | Bacteria | 56322 |
| 8 | Ga0466723_229569 | 3300042618 | Bacteria | 135891 |
| 9 | Ga0466723_313185 | 3300042618 | Bacteria | 1185 |
| 10 | Ga0466728_119528 | 3300042620 | Bacteria | 22681 |
| 11 | Ga0466728_201997 | 3300042620 | Bacteria | 2419 |
| 12 | Ga0466692_060044 | 3300042591 | Bacteria | 6044 |
| 13 | Ga0466693_032365 | 3300042592 | Bacteria | 2780 |
| 14 | Ga0466691_137378 | 3300042593 | Bacteria | 3325 |
| 15 | Ga0466691_217877 | 3300042593 | Bacteria | 6079 |
| 16 | Ga0466694_304214 | 3300042594 | Bacteria | 1126 |
| 17 | Ga0466735_016615 | 3300042624 | Bacteria | 2013 |
| 18 | Ga0466704_474733 | 3300042643 | Bacteria | 2901 |
| 19 | AustNasuHG_c1013033 | 3300000089 | Bacteria | 2859 |
| 20 | Ga0466719_152400 | 3300042606 | Bacteria | 2524 |
| 21 | Ga0466722_000120 | 3300042609 | Bacteria | 3665 |
| 22 | Ga0466705_414329 | 3300042612 | Bacteria | 10412 |
| 23 | Ga0466715_015511 | 3300042616 | Bacteria | 3177 |
| 24 | Ga0466715_152140 | 3300042616 | Bacteria | 2616 |
| 25 | Ga0466726_128123 | 3300042619 | Bacteria | 1840 |
| 26 | Ga0264413_159477 | 3300024493 | Bacteria | 1088 |
| 27 | Ga0466704_250379 | 3300042643 | Bacteria | 3965 |
| 28 | Ga0466704_309115 | 3300042643 | Bacteria | 4577 |
| 29 | Ga0466709_236114 | 3300042648 | Bacteria | 5884 |
| 30 | Ga0466708_236116 | 3300042652 | Bacteria | 1776 |
| 31 | Ga0466727_117731 | 3300042655 | Bacteria | 1896 |
| 32 | Ga0123357_10182739 | 3300009784 | Bacteria | 2442 |
| 33 | AustNasuHG_c1001942 | 3300000089 | Bacteria | 7446 |
| 34 | JGI24695J34938_10070567 | 3300002450 | Bacteria | 1461 |
| 35 | Ga0466707_301029 | 3300042601 | Bacteria | 7956 |
| 36 | Ga0466716_096997 | 3300042605 | Bacteria | 3167 |
| 37 | Ga0466719_106779 | 3300042606 | Bacteria | 10521 |
| 38 | Ga0466711_038973 | 3300042615 | Bacteria | 29172 |
| 39 | Ga0466711_195513 | 3300042615 | Bacteria | 2296 |
| 40 | Ga0466715_524989 | 3300042616 | Bacteria | 2947 |
| 41 | Ga0466723_307869 | 3300042618 | Bacteria | 4870 |
| 42 | Ga0415639_125666 | 3300038395 | Bacteria | 1190 |
| 43 | Ga0466691_200294 | 3300042593 | Bacteria | 5662 |
| 44 | Ga0466694_085565 | 3300042594 | Bacteria | 1249 |
| 45 | Ga0466696_414443 | 3300042596 | Bacteria | 6316 |
| 46 | Ga0466709_410668 | 3300042648 | Bacteria | 1297 |
| 47 | Ga0466708_129363 | 3300042652 | Bacteria | 25678 |
| 48 | Ga0466707_256033 | 3300042601 | Bacteria | 1210 |
| 49 | Ga0466722_108537 | 3300042609 | Bacteria | 13976 |
| 50 | Ga0466705_488157 | 3300042612 | Bacteria | 3513 |
| 51 | Ga0466723_166933 | 3300042618 | Bacteria | 1052 |
| 52 | Ga0466728_090418 | 3300042620 | Bacteria | 7669 |
| 53 | Ga0466728_131555 | 3300042620 | Bacteria | 2813 |
| 54 | Ga0466690_222531 | 3300042590 | Bacteria | 10767 |
| 55 | Ga0466691_021546 | 3300042593 | Bacteria | 6091 |
| 56 | Ga0466695_099873 | 3300042595 | Bacteria | 4687 |
| 57 | Ga0466709_274018 | 3300042648 | Bacteria | 2402 |
| 58 | Ga0466708_060309 | 3300042652 | Bacteria | 1812 |
| 59 | JGI24705J35276_12227914 | 3300002504 | Bacteria | 3089 |
| 60 | Ga0466719_316739 | 3300042606 | Bacteria | 2922 |
| 61 | Ga0466705_123311 | 3300042612 | Bacteria | 5591 |
| 62 | Ga0466711_334274 | 3300042615 | Bacteria | 18177 |
| 63 | Ga0466726_340919 | 3300042619 | Unclassified | 1015 |
| 64 | Ga0466728_067000 | 3300042620 | Bacteria | 10024 |
| 65 | Ga0466692_107587 | 3300042591 | Bacteria | 1470 |
| 66 | Ga0466694_297201 | 3300042594 | Bacteria | 4949 |
| 67 | Ga0466696_012727 | 3300042596 | Bacteria | 6837 |
| 68 | Ga0466696_415076 | 3300042596 | Bacteria | 5320 |
| 69 | Ga0466709_107705 | 3300042648 | Bacteria | 11751 |
| 70 | Ga0466708_006119 | 3300042652 | Bacteria | 8932 |
| 71 | Ga0466708_075050 | 3300042652 | Bacteria | 1662 |
| 72 | Ga0466708_146527 | 3300042652 | Bacteria | 7314 |
| 73 | Ga0123353_10156616 | 3300010167 | Bacteria | 3630 |
| 74 | Ga0123353_10728575 | 3300010167 | Bacteria | 1385 |
| 75 | Ga0123354_10562712 | 3300010882 | Bacteria | 854 |
| 76 | Ga0466707_055485 | 3300042601 | Bacteria | 1333 |
| 77 | Ga0466719_003934 | 3300042606 | Bacteria | 3482 |
| 78 | Ga0466720_053943 | 3300042607 | Bacteria | 2174 |
| 79 | Ga0466722_075561 | 3300042609 | Bacteria | 3124 |
| 80 | Ga0466705_261585 | 3300042612 | Bacteria | 9487 |
| 81 | Ga0466705_396067 | 3300042612 | Bacteria | 1456 |
| 82 | Ga0466715_006809 | 3300042616 | Bacteria | 5592 |
| 83 | Ga0466726_431901 | 3300042619 | Bacteria | 1449 |
| 84 | Ga0466728_324764 | 3300042620 | Bacteria | 1876 |
| 85 | Ga0466729_259851 | 3300042621 | Bacteria | 2857 |
| 86 | Ga0466704_475542 | 3300042643 | Bacteria | 1086 |
| 87 | Ga0466708_047441 | 3300042652 | Bacteria | 3003 |
| 88 | Ga0466708_096531 | 3300042652 | Bacteria | 1951 |
| 89 | Ga0123357_10198356 | 3300009784 | Bacteria | 2292 |
| 90 | Ga0123353_10306896 | 3300010167 | Bacteria | 2418 |
| 91 | Ga0466719_332659 | 3300042606 | Bacteria | 2319 |
| 92 | Ga0466719_459331 | 3300042606 | Bacteria | 11143 |
| 93 | Ga0466722_054182 | 3300042609 | Bacteria | 2191 |
| 94 | Ga0466722_237646 | 3300042609 | Bacteria | 1833 |
| 95 | Ga0466711_376987 | 3300042615 | Bacteria | 1168 |
| 96 | Ga0466715_054271 | 3300042616 | Bacteria | 9457 |
| 97 | Ga0466715_121320 | 3300042616 | Bacteria | 10399 |
| 98 | Ga0466715_137698 | 3300042616 | Bacteria | 1569 |
| 99 | Ga0466715_156625 | 3300042616 | Bacteria | 2892 |
| 100 | Ga0466715_228370 | 3300042616 | Bacteria | 4152 |
| 101 | Ga0466715_518914 | 3300042616 | Bacteria | 2448 |
| 102 | Ga0466694_069808 | 3300042594 | Bacteria | 7838 |
| 103 | Ga0466704_130381 | 3300042643 | Bacteria | 5516 |
| 104 | Ga0466704_354677 | 3300042643 | Bacteria | 30303 |
| 105 | Ga0466704_433461 | 3300042643 | Bacteria | 3953 |
| 106 | Ga0466709_201551 | 3300042648 | Bacteria | 5773 |
| 107 | Ga0466709_291870 | 3300042648 | Bacteria | 15952 |
| 108 | Ga0466709_305677 | 3300042648 | Bacteria | 1310 |
| 109 | Ga0466708_156432 | 3300042652 | Bacteria | 1479 |
| 110 | Ga0466727_330145 | 3300042655 | Bacteria | 1430 |
| 111 | Ga0123357_10576460 | 3300009784 | Bacteria | 880 |
| 112 | Ga0466707_266256 | 3300042601 | Bacteria | 2676 |
| 113 | Ga0466707_326746 | 3300042601 | Bacteria | 1056 |
| 114 | Ga0466713_126061 | 3300042602 | Bacteria | 5285 |
| 115 | Ga0466719_271434 | 3300042606 | Bacteria | 2262 |
| 116 | Ga0466705_124948 | 3300042612 | Bacteria | 1910 |
| 117 | Ga0466705_459639 | 3300042612 | Bacteria | 8763 |
| 118 | Ga0466711_341939 | 3300042615 | Bacteria | 29295 |
| 119 | Ga0466718_060812 | 3300042617 | Bacteria | 2899 |
| 120 | Ga0466723_050301 | 3300042618 | Bacteria | 15280 |
| 121 | Ga0466726_035140 | 3300042619 | Bacteria | 13387 |
| 122 | Ga0466690_306174 | 3300042590 | Unclassified | 1151 |
| 123 | Ga0466696_050893 | 3300042596 | Bacteria | 3662 |
| 124 | Ga0466735_214883 | 3300042624 | Bacteria | 1252 |
| 125 | Ga0466735_230763 | 3300042624 | Bacteria | 1936 |
| 126 | Ga0466703_046184 | 3300042636 | Bacteria | 8350 |
| 127 | Ga0466703_101873 | 3300042636 | Bacteria | 27649 |
| 128 | Ga0466708_334651 | 3300042652 | Bacteria | 78030 |
| 129 | Ga0123357_10197792 | 3300009784 | Bacteria | 2297 |
| 130 | Ga0072941_1290018 | 3300005201 | Bacteria | 1401 |
| 131 | Ga0466707_032040 | 3300042601 | Bacteria | 2112 |
| 132 | Ga0466707_095003 | 3300042601 | Bacteria | 2815 |
| 133 | Ga0466719_140783 | 3300042606 | Bacteria | 2775 |
| 134 | Ga0466719_311982 | 3300042606 | Bacteria | 4088 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.