Protein Family IF05860
Metagenome
Isolate
130
Members
54
Samples
118
Scaffolds
156.87
Avg Length
Representative Sequence
- ID
- 3300042601|Ga0466707_159640|Ga0466707_159640_364_909
- Length
- 181 aa
- Sequence
- MNTVEIDSNIEESEEVPLGLQIDWLKNVVPFVEAALARLDIDDWELSVLFCADPFIAALNKQYRGIEAPTDVLSFSQEDTHIAGDIVISVDTLARNARDFKVPADEELKRLLVHGILHLAGYDHGDSLLPPKKMPTLSPKNKLGTSPQQEMLALQERVLTELSDYSIINKRSFRQDTIWEY
Sample Types
Isolate
9.2%
Metagenome
90.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.2%
Unclassified
25.0%
Kalotermitidae
19.2%
Termopsidae
7.7%
Rhinotermitidae
3.8%
Taxonomy
Archaea
0
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 2 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 3 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 4 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 5 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 6 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 7 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 10 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 11 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 12 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 13 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 14 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 15 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 19 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 20 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 21 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 22 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 27 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 31 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 32 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 40 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 41 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 42 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 43 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 46 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 47 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 48 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 49 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 50 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 51 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 52 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 53 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 54 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_270247 | 3300042612 | Bacteria | 6776 |
| 2 | Ga0123356_10001164 | 3300010049 | Bacteria | 29125 |
| 3 | Ga0123356_12084569 | 3300010049 | Bacteria | 708 |
| 4 | Ga0264413_100299 | 3300024493 | Bacteria | 10426 |
| 5 | Ga0466694_072755 | 3300042594 | Bacteria | 1132 |
| 6 | Ga0466696_304693 | 3300042596 | Bacteria | 1401 |
| 7 | Ga0466699_370982 | 3300042597 | Bacteria | 1268 |
| 8 | JGI24698J34947_10003945 | 3300002449 | Bacteria | 8069 |
| 9 | JGI24698J34947_10017994 | 3300002449 | Bacteria | 3824 |
| 10 | Ga0068302_10682953 | 3300005071 | Bacteria | 1267 |
| 11 | Ga0072941_1012814 | 3300005201 | Bacteria | 13104 |
| 12 | Ga0466707_389429 | 3300042601 | Bacteria | 1106 |
| 13 | Ga0466732_196151 | 3300042656 | Bacteria | 1776 |
| 14 | Ga0466733_023296 | 3300042659 | Bacteria | 1233 |
| 15 | Ga0123353_10792608 | 3300010167 | Bacteria | 1310 |
| 16 | Ga0466694_327373 | 3300042594 | Bacteria | 1636 |
| 17 | JGI24698J34947_10061614 | 3300002449 | Bacteria | 1845 |
| 18 | JGI24695J34938_10068440 | 3300002450 | Bacteria | 1491 |
| 19 | JGI24705J35276_12163611 | 3300002504 | Bacteria | 1247 |
| 20 | Ga0072940_1013075 | 3300005200 | Bacteria | 3309 |
| 21 | Ga0466726_450630 | 3300042619 | Bacteria | 1937 |
| 22 | Ga0466728_374556 | 3300042620 | Bacteria | 6789 |
| 23 | Ga0466707_011661 | 3300042601 | Bacteria | 3585 |
| 24 | Ga0466719_148988 | 3300042606 | Bacteria | 1327 |
| 25 | Ga0466719_441205 | 3300042606 | Bacteria | 7575 |
| 26 | Ga0466720_197641 | 3300042607 | Bacteria | 23703 |
| 27 | Ga0466735_054450 | 3300042624 | Bacteria | 2108 |
| 28 | Ga0415639_143791 | 3300038395 | Bacteria | 1152 |
| 29 | JGI24698J34947_10047704 | 3300002449 | Bacteria | 2173 |
| 30 | JGI24698J34947_10086768 | 3300002449 | Bacteria | 1449 |
| 31 | JGI24698J34947_10105791 | 3300002449 | Bacteria | 1253 |
| 32 | JGI24695J34938_10000276 | 3300002450 | Bacteria | 50333 |
| 33 | JGI24695J34938_10025686 | 3300002450 | Bacteria | 2811 |
| 34 | JGI24695J34938_10048065 | 3300002450 | Bacteria | 1881 |
| 35 | JGI24699J35502_11040910 | 3300002509 | Bacteria | 1575 |
| 36 | Ga0466712_004881 | 3300042614 | Bacteria | 10297 |
| 37 | Ga0466707_285051 | 3300042601 | Bacteria | 1512 |
| 38 | Ga0466707_292693 | 3300042601 | Bacteria | 1999 |
| 39 | Ga0466720_163600 | 3300042607 | Bacteria | 14544 |
| 40 | Ga0466698_196416 | 3300042610 | Bacteria | 1236 |
| 41 | JGI24698J34947_10100408 | 3300002449 | Bacteria | 1303 |
| 42 | JGI24698J34947_10101052 | 3300002449 | Bacteria | 1297 |
| 43 | JGI24695J34938_10000201 | 3300002450 | Bacteria | 56424 |
| 44 | JGI24695J34938_10000659 | 3300002450 | Bacteria | 32678 |
| 45 | JGI24695J34938_10018603 | 3300002450 | Unclassified | 3467 |
| 46 | Ga0466712_315661 | 3300042614 | Bacteria | 20765 |
| 47 | Ga0466707_159640 | 3300042601 | Bacteria | 2079 |
| 48 | Ga0466716_402638 | 3300042605 | Bacteria | 8337 |
| 49 | Ga0466720_137681 | 3300042607 | Bacteria | 22704 |
| 50 | Ga0466729_265273 | 3300042621 | Bacteria | 1139 |
| 51 | Ga0466731_338092 | 3300042622 | Bacteria | 1626 |
| 52 | Ga0466704_031565 | 3300042643 | Bacteria | 14824 |
| 53 | Ga0466704_346148 | 3300042643 | Bacteria | 1226 |
| 54 | Ga0466705_060150 | 3300042612 | Bacteria | 42844 |
| 55 | Ga0123356_10000042 | 3300010049 | Bacteria | 135091 |
| 56 | Ga0123356_10052706 | 3300010049 | Bacteria | 3785 |
| 57 | Ga0123356_10885217 | 3300010049 | Bacteria | 1064 |
| 58 | Ga0123356_11766090 | 3300010049 | Bacteria | 768 |
| 59 | AustNasuHG_c1023060 | 3300000089 | Bacteria | 1992 |
| 60 | JGI24698J34947_10034039 | 3300002449 | Bacteria | 2669 |
| 61 | JGI24698J34947_10130601 | 3300002449 | Bacteria | 1074 |
| 62 | Ga0072941_1030470 | 3300005201 | Bacteria | 4185 |
| 63 | Ga0072941_1069869 | 3300005201 | Bacteria | 2006 |
| 64 | Ga0072941_1098072 | 3300005201 | Bacteria | 1782 |
| 65 | Ga0466715_116881 | 3300042616 | Bacteria | 4780 |
| 66 | Ga0466707_229876 | 3300042601 | Bacteria | 1306 |
| 67 | Ga0466707_366473 | 3300042601 | Bacteria | 2146 |
| 68 | Ga0466722_017520 | 3300042609 | Bacteria | 32151 |
| 69 | Ga0466702_125791 | 3300042635 | Bacteria | 1201 |
| 70 | Ga0466703_080253 | 3300042636 | Bacteria | 1470 |
| 71 | Ga0466704_545136 | 3300042643 | Bacteria | 1001 |
| 72 | Ga0123354_10449277 | 3300010882 | Bacteria | 1045 |
| 73 | Ga0123354_10508682 | 3300010882 | Bacteria | 934 |
| 74 | Ga0466694_189698 | 3300042594 | Bacteria | 15080 |
| 75 | Ga0072941_1016635 | 3300005201 | Bacteria | 20897 |
| 76 | Ga0072941_1191126 | 3300005201 | Bacteria | 1199 |
| 77 | Ga0466721_128130 | 3300042608 | Bacteria | 2306 |
| 78 | Ga0466708_236919 | 3300042652 | Bacteria | 12140 |
| 79 | Ga0466727_148700 | 3300042655 | Bacteria | 10958 |
| 80 | Ga0466732_252112 | 3300042656 | Bacteria | 23763 |
| 81 | Ga0123356_10000424 | 3300010049 | Bacteria | 48165 |
| 82 | Ga0123356_11776961 | 3300010049 | Bacteria | 766 |
| 83 | Ga0466690_052561 | 3300042590 | Bacteria | 4719 |
| 84 | Ga0466694_036976 | 3300042594 | Bacteria | 1792 |
| 85 | Ga0466696_253695 | 3300042596 | Bacteria | 2190 |
| 86 | Ga0466696_335069 | 3300042596 | Bacteria | 23035 |
| 87 | Ga0466699_282407 | 3300042597 | Bacteria | 1965 |
| 88 | AustNasuHG_c1028124 | 3300000089 | Bacteria | 1690 |
| 89 | JGI24698J34947_10001557 | 3300002449 | Bacteria | 12136 |
| 90 | JGI24698J34947_10016249 | 3300002449 | Bacteria | 4041 |
| 91 | JGI24698J34947_10063560 | 3300002449 | Bacteria | 1808 |
| 92 | JGI24698J34947_10094024 | 3300002449 | Bacteria | 1367 |
| 93 | JGI24695J34938_10000567 | 3300002450 | Bacteria | 35569 |
| 94 | JGI24702J35022_10122016 | 3300002462 | Bacteria | 1440 |
| 95 | Ga0466726_404177 | 3300042619 | Bacteria | 25452 |
| 96 | Ga0466707_082116 | 3300042601 | Bacteria | 1895 |
| 97 | Ga0466707_344736 | 3300042601 | Bacteria | 2460 |
| 98 | Ga0466720_048903 | 3300042607 | Bacteria | 5725 |
| 99 | Ga0466735_040751 | 3300042624 | Bacteria | 1329 |
| 100 | Ga0466727_096910 | 3300042655 | Bacteria | 14290 |
| 101 | Ga0123356_13301847 | 3300010049 | Bacteria | 561 |
| 102 | Ga0466694_089913 | 3300042594 | Bacteria | 1689 |
| 103 | Ga0466699_012235 | 3300042597 | Bacteria | 1161 |
| 104 | Ga0466699_095860 | 3300042597 | Bacteria | 1389 |
| 105 | JGI24698J34947_10073279 | 3300002449 | Bacteria | 1635 |
| 106 | JGI24698J34947_10101154 | 3300002449 | Bacteria | 1296 |
| 107 | JGI24695J34938_10012069 | 3300002450 | Bacteria | 4606 |
| 108 | JGI24702J35022_10149212 | 3300002462 | Bacteria | 1311 |
| 109 | Ga0466712_003887 | 3300042614 | Bacteria | 35817 |
| 110 | Ga0466712_009175 | 3300042614 | Bacteria | 17547 |
| 111 | Ga0466712_026871 | 3300042614 | Bacteria | 18582 |
| 112 | Ga0466718_126067 | 3300042617 | Bacteria | 1722 |
| 113 | Ga0466707_236186 | 3300042601 | Bacteria | 1132 |
| 114 | Ga0466717_034372 | 3300042604 | Bacteria | 1143 |
| 115 | Ga0466735_029768 | 3300042624 | Bacteria | 2369 |
| 116 | Ga0466703_049156 | 3300042636 | Bacteria | 5598 |
| 117 | Ga0466703_101873 | 3300042636 | Bacteria | 27649 |
| 118 | Ga0466703_113927 | 3300042636 | Bacteria | 4637 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02130 | YbeY | Endoribonuclease YbeY | 31 | 126 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.