Protein Family IF05755

Metagenome Isolate
134 Members
37 Samples
129 Scaffolds
112.81 Avg Length

🧬 Representative Sequence

ID
3300042600|Ga0466700_420273|Ga0466700_420273_890_1276
Length
128 aa
Sequence
MVGDLMIEVLYLIRRRTMQVQDVRVTIRVNRELKESAEELFEYLGLNMSNAVNIFLRKAVDQKGIPFPVNTGNQGVGGLSADEVTNAFKNVVRQDIAIKQKKGLPVARYDTKSGRAYLENADGTKDYV

📊 Sample Types

Isolate 3.7%
Metagenome 96.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 73.5%
Unclassified 14.7%
Kalotermitidae 11.8%

🌳 Taxonomy

Archaea 0
Bacteria 113
Eukaryota 0
Viruses 0
Unclassified 21

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
5 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
6 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
7 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
8 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
9 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
10 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
11 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
12 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
13 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
17 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
18 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
19 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
20 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
21 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
22 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
23 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
24 2781125687 Treponema sp. Lab288P4bin29 Isolate Unclassified
25 2781125696 Treponema sp. Th196P4bin22 Isolate Unclassified
26 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
27 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
28 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
29 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
30 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
31 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
32 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
33 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
34 2781125631 Treponema sp. Nt197P3bin89 Isolate Unclassified
35 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
36 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
37 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 AustNasuHG_c1006395 3300000089 Bacteria 4206
2 JGI24698J34947_10000357 3300002449 Bacteria 20410
3 JGI24698J34947_10012019 3300002449 Bacteria 4753
4 JGI24702J35022_10008893 3300002462 Bacteria 5667
5 JGI24702J35022_10341982 3300002462 Bacteria 892
6 Ga0072941_1145755 3300005201 Bacteria 1638
7 Ga0123357_10781098 3300009784 Bacteria 653
8 Ga0123356_10448562 3300010049 Bacteria 1438
9 Ga0466705_240790 3300042612 Bacteria 2049
10 Ga0466694_126492 3300042594 Bacteria 2539
11 Ga0466699_304554 3300042597 Bacteria 1409
12 Ga0466733_120284 3300042659 Bacteria 5468
13 Ga0466702_135996 3300042635 Bacteria 3360
14 Ga0466703_201663 3300042636 Bacteria 26897
15 Ga0466712_122177 3300042614 Bacteria 11287
16 Ga0466718_013707 3300042617 Bacteria 9457
17 Ga0466700_420273 3300042600 Bacteria 1923
18 JGI24695J34938_10095099 3300002450 Bacteria 1220
19 JGI24697J35500_10894910 3300002507 Bacteria 803
20 Ga0072941_1342245 3300005201 Bacteria 1048
21 Ga0123356_10612682 3300010049 Bacteria 1254
22 Ga0123356_12832461 3300010049 Unclassified 607
23 Ga0466733_103180 3300042659 Bacteria 5035
24 Ga0466734_082166 3300042623 Bacteria 1357
25 Ga0466702_318900 3300042635 Bacteria 2444
26 Ga0466704_197307 3300042643 Bacteria 4957
27 Ga0466717_246989 3300042604 Bacteria 2914
28 JGI24698J34947_10028234 3300002449 Unclassified 2973
29 JGI24698J34947_10039208 3300002449 Unclassified 2453
30 JGI24698J34947_10055106 3300002449 Unclassified 1982
31 JGI24698J34947_10064848 3300002449 Bacteria 1783
32 JGI24698J34947_10122444 3300002449 Bacteria 1126
33 JGI24695J34938_10325900 3300002450 Bacteria 669
34 JGI24702J35022_10770779 3300002462 Bacteria 599
35 Ga0072941_1010035 3300005201 Bacteria 2820
36 Ga0072941_1050431 3300005201 Bacteria 3428
37 Ga0123356_10490916 3300010049 Bacteria 1382
38 Ga0123356_11096389 3300010049 Bacteria 964
39 Ga0466705_379534 3300042612 Bacteria 2171
40 Ga0466699_060018 3300042597 Bacteria 3386
41 Ga0466699_276103 3300042597 Unclassified 4146
42 Ga0466731_095441 3300042622 Bacteria 1504
43 Ga0466702_147148 3300042635 Bacteria 1022
44 Ga0466698_254784 3300042610 Bacteria 1784
45 Ga0466698_327681 3300042610 Bacteria 1241
46 FAAS_10282243 3300001880 Unclassified 533
47 JGI24698J34947_10083496 3300002449 Unclassified 1490
48 JGI24698J34947_10273481 3300002449 Bacteria 620
49 JGI24705J35276_12025105 3300002504 Bacteria 880
50 Ga0123356_10001968 3300010049 Bacteria 22243
51 Ga0123356_10004494 3300010049 Bacteria 14403
52 Ga0466704_268575 3300042643 Bacteria 4110
53 Ga0466712_002978 3300042614 Bacteria 5936
54 Ga0466712_068928 3300042614 Bacteria 18171
55 Ga0466712_322623 3300042614 Bacteria 21024
56 Ga0466719_094844 3300042606 Bacteria 1512
57 JGI24698J34947_10043290 3300002449 Unclassified 2309
58 JGI24698J34947_10091771 3300002449 Bacteria 1391
59 Ga0072940_1375757 3300005200 Bacteria 739
60 Ga0123356_10023975 3300010049 Bacteria 5742
61 Ga0123356_11207624 3300010049 Bacteria 922
62 Ga0123356_12461635 3300010049 Bacteria 651
63 Ga0123356_13771354 3300010049 Bacteria 523
64 Ga0123353_10642743 3300010167 Bacteria 1504
65 Ga0415639_137796 3300038395 Bacteria 3639
66 Ga0466699_072246 3300042597 Bacteria 3465
67 Ga0466699_443742 3300042597 Bacteria 3319
68 Ga0466702_283333 3300042635 Bacteria 1098
69 Ga0466704_247512 3300042643 Bacteria 14010
70 Ga0466712_122362 3300042614 Unclassified 2001
71 Ga0466712_202159 3300042614 Bacteria 13292
72 Ga0466718_031661 3300042617 Bacteria 1968
73 Ga0466720_172730 3300042607 Bacteria 3349
74 Ga0466698_174068 3300042610 Bacteria 1455
75 Ga0466698_502893 3300042610 Unclassified 6021
76 JGI24698J34947_10073906 3300002449 Unclassified 1625
77 JGI24698J34947_10080393 3300002449 Bacteria 1531
78 JGI24698J34947_10153257 3300002449 Bacteria 954
79 Ga0072941_1069242 3300005201 Bacteria 2681
80 Ga0072941_1200111 3300005201 Bacteria 693
81 Ga0123353_11884484 3300010167 Bacteria 738
82 Ga0123354_10042664 3300010882 Unclassified 6987
83 Ga0415639_071478 3300038395 Bacteria 1952
84 Ga0466699_018127 3300042597 Bacteria 10145
85 Ga0466699_132153 3300042597 Unclassified 1258
86 Ga0466733_209798 3300042659 Bacteria 4324
87 Ga0466731_380364 3300042622 Bacteria 1021
88 Ga0466731_410933 3300042622 Bacteria 1015
89 Ga0466721_134390 3300042608 Bacteria 1943
90 Ga0466698_084264 3300042610 Bacteria 11540
91 JGI24698J34947_10001257 3300002449 Bacteria 13262
92 JGI24698J34947_10098711 3300002449 Bacteria 1319
93 JGI24702J35022_10001475 3300002462 Bacteria 14598
94 Ga0072941_1129478 3300005201 Bacteria 2548
95 Ga0072941_1465950 3300005201 Unclassified 965
96 Ga0123357_10096099 3300009784 Bacteria 3838
97 Ga0123356_10153737 3300010049 Bacteria 2288
98 Ga0123356_10242685 3300010049 Bacteria 1874
99 Ga0123356_11461846 3300010049 Bacteria 842
100 Ga0123356_11739213 3300010049 Bacteria 774
101 Ga0264413_144763 3300024493 Bacteria 2128
102 Ga0466699_024421 3300042597 Bacteria 2849
103 Ga0466699_170884 3300042597 Bacteria 1009
104 Ga0466699_265552 3300042597 Unclassified 1114
105 Ga0466733_059843 3300042659 Unclassified 1099
106 Ga0466705_476401 3300042612 Bacteria 1213
107 Ga0466712_299692 3300042614 Unclassified 5780
108 Ga0466718_106264 3300042617 Bacteria 1338
109 AustNasuHG_c1013848 3300000089 Bacteria 2756
110 JGI24698J34947_10025006 3300002449 Unclassified 3182
111 JGI24698J34947_10070601 3300002449 Bacteria 1680
112 JGI24698J34947_10311563 3300002449 Unclassified 563
113 JGI24695J34938_10311587 3300002450 Bacteria 683
114 JGI24702J35022_10002720 3300002462 Bacteria 10722
115 Ga0072941_1083063 3300005201 Bacteria 739
116 Ga0123356_10341431 3300010049 Bacteria 1618
117 Ga0123353_10744530 3300010167 Unclassified 1365
118 Ga0123353_11968346 3300010167 Bacteria 717
119 Ga0123353_12495866 3300010167 Unclassified 615
120 Ga0466705_283169 3300042612 Bacteria 3144
121 Ga0466699_070621 3300042597 Bacteria 2022
122 Ga0466699_080172 3300042597 Bacteria 1164
123 Ga0466699_370313 3300042597 Bacteria 1263
124 Ga0466731_010446 3300042622 Bacteria 4094
125 Ga0466731_171274 3300042622 Bacteria 1176
126 Ga0466702_416914 3300042635 Bacteria 1359
127 Ga0466712_022854 3300042614 Bacteria 2884
128 Ga0466712_122133 3300042614 Bacteria 1567
129 Ga0466718_169567 3300042617 Bacteria 1626

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042614 Ga0466712_022854 Ga0466712_022854_557_871 104
2 3300002449 JGI24698J34947_10273481 JGI24698J34947_102734811 105
3 3300042612 Ga0466705_476401 Ga0466705_476401_873_1190 105
4 3300024493 Ga0264413_144763 Ga0264413_1447632 111
5 3300038395 Ga0415639_071478 Ga0415639_071478_1207_1542 111
6 3300038395 Ga0415639_137796 Ga0415639_137796_2640_2975 111
7 3300042597 Ga0466699_018127 Ga0466699_018127_3524_3859 111
8 3300042597 Ga0466699_070621 Ga0466699_070621_1450_1785 111
9 3300042597 Ga0466699_072246 Ga0466699_072246_2829_3164 111
10 3300042597 Ga0466699_080172 Ga0466699_080172_674_1009 111
11 3300042597 Ga0466699_132153 Ga0466699_132153_217_552 111
12 3300042597 Ga0466699_170884 Ga0466699_170884_515_850 111
13 3300042597 Ga0466699_265552 Ga0466699_265552_749_1084 111
14 3300042597 Ga0466699_276103 Ga0466699_276103_959_1294 111
15 3300042597 Ga0466699_370313 Ga0466699_370313_858_1193 111
16 3300042597 Ga0466699_443742 Ga0466699_443742_790_1125 111
17 3300042604 Ga0466717_246989 Ga0466717_246989_763_1098 111
18 3300042607 Ga0466720_172730 Ga0466720_172730_1330_1665 111
19 3300042608 Ga0466721_134390 Ga0466721_134390_447_782 111
20 3300042610 Ga0466698_254784 Ga0466698_254784_455_790 111
21 3300042610 Ga0466698_327681 Ga0466698_327681_320_655 111
22 3300042610 Ga0466698_502893 Ga0466698_502893_5542_5877 111
23 3300042614 Ga0466712_002978 Ga0466712_002978_5583_5918 111
24 3300042614 Ga0466712_068928 Ga0466712_068928_6752_7087 111
25 3300042614 Ga0466712_122133 Ga0466712_122133_218_553 111
26 3300042614 Ga0466712_122362 Ga0466712_122362_1613_1948 111
27 3300042614 Ga0466712_299692 Ga0466712_299692_424_759 111
28 3300042614 Ga0466712_322623 Ga0466712_322623_20425_20760 111
29 3300042617 Ga0466718_013707 Ga0466718_013707_950_1285 111
30 3300042617 Ga0466718_031661 Ga0466718_031661_893_1228 111
31 3300042617 Ga0466718_106264 Ga0466718_106264_548_883 111
32 3300042617 Ga0466718_169567 Ga0466718_169567_832_1167 111
33 3300042622 Ga0466731_010446 Ga0466731_010446_3709_4044 111
34 3300042622 Ga0466731_095441 Ga0466731_095441_371_706 111
35 3300042622 Ga0466731_171274 Ga0466731_171274_806_1141 111
36 3300042622 Ga0466731_410933 Ga0466731_410933_156_491 111
37 3300042623 Ga0466734_082166 Ga0466734_082166_94_429 111
38 3300042635 Ga0466702_283333 Ga0466702_283333_567_902 111
39 3300042635 Ga0466702_318900 Ga0466702_318900_1777_2112 111
40 3300042635 Ga0466702_416914 Ga0466702_416914_816_1151 111
41 3300042659 Ga0466733_059843 Ga0466733_059843_667_1002 111
42 3300042659 Ga0466733_103180 Ga0466733_103180_899_1234 111
43 3300042659 Ga0466733_120284 Ga0466733_120284_1778_2113 111
44 3300042659 Ga0466733_209798 Ga0466733_209798_1933_2268 111
45 iso_pr_bacteria 2781125630 2781265652 111
46 iso_pr_bacteria 2781125631 2781268474 111
47 iso_pr_bacteria 2781125660 2781331976 111
48 iso_pr_bacteria 2781125687 2781420257 111
49 iso_pr_bacteria 2781125696 2781439994 111
50 3300000089 AustNasuHG_c1006395 AustNasuHG_10063954 112
51 3300000089 AustNasuHG_c1013848 AustNasuHG_10138483 112
52 3300001880 FAAS_10282243 FAAS_102822431 112
53 3300002449 JGI24698J34947_10000357 JGI24698J34947_1000035710 112
54 3300002449 JGI24698J34947_10001257 JGI24698J34947_100012578 112
55 3300002449 JGI24698J34947_10028234 JGI24698J34947_100282343 112
56 3300002449 JGI24698J34947_10039208 JGI24698J34947_100392083 112
57 3300002449 JGI24698J34947_10043290 JGI24698J34947_100432903 112
58 3300002449 JGI24698J34947_10055106 JGI24698J34947_100551062 112
59 3300002449 JGI24698J34947_10064848 JGI24698J34947_100648483 112
60 3300002449 JGI24698J34947_10070601 JGI24698J34947_100706012 112
61 3300002449 JGI24698J34947_10073906 JGI24698J34947_100739063 112
62 3300002449 JGI24698J34947_10080393 JGI24698J34947_100803931 112
63 3300002449 JGI24698J34947_10083496 JGI24698J34947_100834963 112
64 3300002449 JGI24698J34947_10091771 JGI24698J34947_100917714 112
65 3300002449 JGI24698J34947_10098711 JGI24698J34947_100987112 112
66 3300002449 JGI24698J34947_10122444 JGI24698J34947_101224442 112
67 3300002449 JGI24698J34947_10153257 JGI24698J34947_101532572 112
68 3300002449 JGI24698J34947_10311563 JGI24698J34947_103115631 112
69 3300002450 JGI24695J34938_10095099 JGI24695J34938_100950992 112
70 3300002450 JGI24695J34938_10325900 JGI24695J34938_103259002 112
71 3300002462 JGI24702J35022_10001475 JGI24702J35022_100014758 112
72 3300002462 JGI24702J35022_10002720 JGI24702J35022_100027205 112
73 3300002462 JGI24702J35022_10008893 JGI24702J35022_100088935 112
74 3300002462 JGI24702J35022_10341982 JGI24702J35022_103419822 112
75 3300002462 JGI24702J35022_10770779 JGI24702J35022_107707792 112
76 3300002504 JGI24705J35276_12025105 JGI24705J35276_120251052 112
77 3300002507 JGI24697J35500_10894910 JGI24697J35500_108949101 112
78 3300005200 Ga0072940_1375757 Ga0072940_13757571 112
79 3300005201 Ga0072941_1010035 Ga0072941_10100351 112
80 3300005201 Ga0072941_1050431 Ga0072941_10504314 112
81 3300005201 Ga0072941_1069242 Ga0072941_10692424 112
82 3300005201 Ga0072941_1083063 Ga0072941_10830631 112
83 3300005201 Ga0072941_1129478 Ga0072941_11294782 112
84 3300005201 Ga0072941_1145755 Ga0072941_11457553 112
85 3300005201 Ga0072941_1200111 Ga0072941_12001111 112
86 3300005201 Ga0072941_1342245 Ga0072941_13422453 112
87 3300005201 Ga0072941_1465950 Ga0072941_14659502 112
88 3300009784 Ga0123357_10096099 Ga0123357_100960992 112
89 3300009784 Ga0123357_10781098 Ga0123357_107810982 112
90 3300010049 Ga0123356_10001968 Ga0123356_1000196820 112
91 3300010049 Ga0123356_10004494 Ga0123356_100044946 112
92 3300010049 Ga0123356_10023975 Ga0123356_100239757 112
93 3300010049 Ga0123356_10153737 Ga0123356_101537372 112
94 3300010049 Ga0123356_10242685 Ga0123356_102426853 112
95 3300010049 Ga0123356_10341431 Ga0123356_103414313 112
96 3300010049 Ga0123356_10448562 Ga0123356_104485621 112
97 3300010049 Ga0123356_10490916 Ga0123356_104909162 112
98 3300010049 Ga0123356_10612682 Ga0123356_106126824 112
99 3300010049 Ga0123356_11096389 Ga0123356_110963892 112
100 3300010049 Ga0123356_11207624 Ga0123356_112076242 112
101 3300010049 Ga0123356_11461846 Ga0123356_114618462 112
102 3300010049 Ga0123356_11739213 Ga0123356_117392132 112
103 3300010049 Ga0123356_12461635 Ga0123356_124616352 112
104 3300010049 Ga0123356_12832461 Ga0123356_128324612 112
105 3300010049 Ga0123356_13771354 Ga0123356_137713541 112
106 3300010167 Ga0123353_10642743 Ga0123353_106427432 112
107 3300010167 Ga0123353_11884484 Ga0123353_118844842 112
108 3300010167 Ga0123353_11968346 Ga0123353_119683462 112
109 3300010167 Ga0123353_12495866 Ga0123353_124958662 112
110 3300010882 Ga0123354_10042664 Ga0123354_100426644 112
111 3300042614 Ga0466712_202159 Ga0466712_202159_2818_3165 115
112 3300042597 Ga0466699_024421 Ga0466699_024421_1580_1930 116
113 3300042597 Ga0466699_060018 Ga0466699_060018_1413_1763 116
114 3300042612 Ga0466705_283169 Ga0466705_283169_858_1211 117
115 3300042612 Ga0466705_379534 Ga0466705_379534_1052_1405 117
116 3300042636 Ga0466703_201663 Ga0466703_201663_16105_16458 117
117 3300042643 Ga0466704_197307 Ga0466704_197307_4309_4662 117
118 3300042643 Ga0466704_247512 Ga0466704_247512_5233_5586 117
119 3300042643 Ga0466704_268575 Ga0466704_268575_3621_3974 117
120 3300042597 Ga0466699_304554 Ga0466699_304554_332_688 118
121 3300042635 Ga0466702_135996 Ga0466702_135996_2819_3175 118
122 3300002450 JGI24695J34938_10311587 JGI24695J34938_103115871 119
123 3300042610 Ga0466698_174068 Ga0466698_174068_623_982 119
124 3300042614 Ga0466712_122177 Ga0466712_122177_7623_7982 119
125 3300002449 JGI24698J34947_10012019 JGI24698J34947_100120195 120
126 3300002449 JGI24698J34947_10025006 JGI24698J34947_100250064 120
127 3300042606 Ga0466719_094844 Ga0466719_094844_631_993 120
128 3300042622 Ga0466731_380364 Ga0466731_380364_411_773 120
129 3300042610 Ga0466698_084264 Ga0466698_084264_8984_9349 121
130 3300010167 Ga0123353_10744530 Ga0123353_107445302 122
131 3300042594 Ga0466694_126492 Ga0466694_126492_868_1236 122
132 3300042612 Ga0466705_240790 Ga0466705_240790_795_1166 123
133 3300042635 Ga0466702_147148 Ga0466702_147148_206_589 127
134 3300042600 Ga0466700_420273 Ga0466700_420273_890_1276 128

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04221 RelB RelB antitoxin 25 70 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.38 0.62 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.