Protein Family IF05305
Metagenome
Isolate
187
Members
48
Samples
181
Scaffolds
161.17
Avg Length
Representative Sequence
- ID
- 3300042597|Ga0466699_133028|Ga0466699_133028_20499_20990
- Length
- 163 aa
- Sequence
- MLKAAFPGSFDPPTLGHLNIIQRAADIFDELFVVIAENRQKKHLFSITERVEMLRKLTEDRRNVTVMVTDSLIVNLMQKEGIKLLLRGVRGSDFSYEFELSMLNKTLDPDIETIFMTTDPKYFVLRSSTIKELASFHGNISGMVPPLVASALEEKYRIDPGTV
Sample Types
Isolate
3.2%
Metagenome
96.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
42.2%
Kalotermitidae
31.1%
Unclassified
13.3%
Termopsidae
8.9%
Rhinotermitidae
4.4%
Taxonomy
Archaea
1
Bacteria
171
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 3 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 4 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 5 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 6 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 7 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 8 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 20 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 21 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 22 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 27 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 28 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 33 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 36 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 37 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 40 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 42 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 43 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 44 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 45 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 46 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 47 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 48 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_125615 | 3300042612 | Bacteria | 2865 |
| 2 | Ga0466690_147738 | 3300042590 | Bacteria | 3760 |
| 3 | Ga0466692_041724 | 3300042591 | Bacteria | 7596 |
| 4 | Ga0466696_173613 | 3300042596 | Bacteria | 6689 |
| 5 | Ga0466696_316985 | 3300042596 | Bacteria | 2916 |
| 6 | Ga0466699_030024 | 3300042597 | Bacteria | 4380 |
| 7 | Ga0466719_082000 | 3300042606 | Bacteria | 4894 |
| 8 | Ga0466719_476935 | 3300042606 | Bacteria | 6112 |
| 9 | Ga0466719_572571 | 3300042606 | Bacteria | 8100 |
| 10 | Ga0466720_161382 | 3300042607 | Bacteria | 5342 |
| 11 | Ga0466722_259056 | 3300042609 | Bacteria | 2089 |
| 12 | Ga0466715_020553 | 3300042616 | Bacteria | 4028 |
| 13 | Ga0466715_210096 | 3300042616 | Bacteria | 1379 |
| 14 | Ga0466715_351093 | 3300042616 | Bacteria | 26289 |
| 15 | Ga0466715_405114 | 3300042616 | Unclassified | 2606 |
| 16 | Ga0466726_058260 | 3300042619 | Unclassified | 1711 |
| 17 | Ga0466726_134934 | 3300042619 | Bacteria | 2828 |
| 18 | JGI24698J34947_10001327 | 3300002449 | Bacteria | 12992 |
| 19 | JGI24698J34947_10093102 | 3300002449 | Bacteria | 1377 |
| 20 | JGI24698J34947_10248569 | 3300002449 | Unclassified | 666 |
| 21 | Ga0466735_034759 | 3300042624 | Bacteria | 2903 |
| 22 | Ga0466704_121244 | 3300042643 | Bacteria | 66950 |
| 23 | Ga0466709_415682 | 3300042648 | Bacteria | 14471 |
| 24 | Ga0466708_136956 | 3300042652 | Bacteria | 10763 |
| 25 | Ga0466708_353348 | 3300042652 | Bacteria | 8553 |
| 26 | Ga0466727_080587 | 3300042655 | Bacteria | 8292 |
| 27 | Ga0466727_262287 | 3300042655 | Unclassified | 1351 |
| 28 | Ga0123356_13549657 | 3300010049 | Bacteria | 540 |
| 29 | Ga0466690_209268 | 3300042590 | Bacteria | 2058 |
| 30 | Ga0466693_249218 | 3300042592 | Bacteria | 2254 |
| 31 | Ga0466693_347313 | 3300042592 | Bacteria | 1927 |
| 32 | Ga0466691_053810 | 3300042593 | Bacteria | 6945 |
| 33 | Ga0466691_133604 | 3300042593 | Bacteria | 19141 |
| 34 | Ga0466699_042905 | 3300042597 | Bacteria | 10075 |
| 35 | Ga0466707_103255 | 3300042601 | Bacteria | 2230 |
| 36 | Ga0466722_213173 | 3300042609 | Bacteria | 10029 |
| 37 | Ga0466723_056206 | 3300042618 | Bacteria | 6896 |
| 38 | Ga0466726_122114 | 3300042619 | Bacteria | 1081 |
| 39 | JGI24698J34947_10075892 | 3300002449 | Unclassified | 1596 |
| 40 | JGI24702J35022_10013025 | 3300002462 | Bacteria | 4612 |
| 41 | Ga0072941_1010218 | 3300005201 | Bacteria | 23583 |
| 42 | Ga0466702_193653 | 3300042635 | Bacteria | 16575 |
| 43 | Ga0466703_262321 | 3300042636 | Bacteria | 2852 |
| 44 | Ga0466704_037742 | 3300042643 | Bacteria | 13459 |
| 45 | Ga0466708_089554 | 3300042652 | Bacteria | 2432 |
| 46 | Ga0466705_085779 | 3300042612 | Bacteria | 1947 |
| 47 | Ga0466732_240055 | 3300042656 | Bacteria | 3033 |
| 48 | Ga0123356_10537889 | 3300010049 | Bacteria | 1328 |
| 49 | Ga0466692_092810 | 3300042591 | Bacteria | 5627 |
| 50 | Ga0466694_118934 | 3300042594 | Bacteria | 28922 |
| 51 | Ga0466694_244817 | 3300042594 | Bacteria | 21258 |
| 52 | Ga0466696_033426 | 3300042596 | Bacteria | 9882 |
| 53 | Ga0466696_376931 | 3300042596 | Bacteria | 4633 |
| 54 | Ga0466699_325230 | 3300042597 | Bacteria | 11502 |
| 55 | Ga0466716_260633 | 3300042605 | Bacteria | 7818 |
| 56 | Ga0466719_206496 | 3300042606 | Bacteria | 9394 |
| 57 | Ga0466722_031745 | 3300042609 | Bacteria | 4547 |
| 58 | Ga0466722_046346 | 3300042609 | Bacteria | 7196 |
| 59 | Ga0466698_239320 | 3300042610 | Bacteria | 3604 |
| 60 | Ga0466712_099835 | 3300042614 | Bacteria | 8380 |
| 61 | Ga0466712_123260 | 3300042614 | Bacteria | 1101 |
| 62 | Ga0466712_193219 | 3300042614 | Bacteria | 1882 |
| 63 | Ga0466718_026489 | 3300042617 | Bacteria | 1750 |
| 64 | JGI24698J34947_10019152 | 3300002449 | Bacteria | 3696 |
| 65 | JGI24698J34947_10020979 | 3300002449 | Unclassified | 3517 |
| 66 | JGI24698J34947_10064762 | 3300002449 | Bacteria | 1785 |
| 67 | JGI24698J34947_10088774 | 3300002449 | Unclassified | 1425 |
| 68 | JGI24695J34938_10059585 | 3300002450 | Bacteria | 1632 |
| 69 | Ga0072941_1122805 | 3300005201 | Bacteria | 1670 |
| 70 | Ga0466731_410392 | 3300042622 | Bacteria | 1003 |
| 71 | Ga0466735_141565 | 3300042624 | Bacteria | 1132 |
| 72 | Ga0466703_040842 | 3300042636 | Bacteria | 2825 |
| 73 | Ga0466703_072240 | 3300042636 | Bacteria | 3142 |
| 74 | Ga0466703_126658 | 3300042636 | Bacteria | 52809 |
| 75 | Ga0466709_168954 | 3300042648 | Bacteria | 1895 |
| 76 | Ga0466708_123569 | 3300042652 | Bacteria | 3856 |
| 77 | Ga0466691_206976 | 3300042593 | Unclassified | 1465 |
| 78 | Ga0466694_276856 | 3300042594 | Bacteria | 1064 |
| 79 | Ga0466696_061509 | 3300042596 | Bacteria | 12818 |
| 80 | Ga0466707_038182 | 3300042601 | Bacteria | 11596 |
| 81 | Ga0466707_389877 | 3300042601 | Bacteria | 1021 |
| 82 | Ga0466717_050602 | 3300042604 | Bacteria | 1116 |
| 83 | Ga0466717_168785 | 3300042604 | Bacteria | 1502 |
| 84 | Ga0466712_030783 | 3300042614 | Bacteria | 7837 |
| 85 | Ga0466712_098440 | 3300042614 | Bacteria | 14141 |
| 86 | Ga0466715_382180 | 3300042616 | Bacteria | 2002 |
| 87 | Ga0466715_467198 | 3300042616 | Bacteria | 3397 |
| 88 | Ga0466723_279514 | 3300042618 | Bacteria | 2718 |
| 89 | Ga0466728_302662 | 3300042620 | Bacteria | 2123 |
| 90 | JGI24698J34947_10078932 | 3300002449 | Bacteria | 1551 |
| 91 | Ga0072940_1087599 | 3300005200 | Bacteria | 2692 |
| 92 | Ga0466735_042167 | 3300042624 | Unclassified | 1279 |
| 93 | Ga0466704_002850 | 3300042643 | Bacteria | 1211 |
| 94 | Ga0466708_085540 | 3300042652 | Bacteria | 4446 |
| 95 | Ga0466708_100585 | 3300042652 | Bacteria | 1813 |
| 96 | Ga0466708_261289 | 3300042652 | Bacteria | 8750 |
| 97 | Ga0466727_002166 | 3300042655 | Bacteria | 1437 |
| 98 | Ga0466727_110614 | 3300042655 | Bacteria | 1149 |
| 99 | Ga0466727_228763 | 3300042655 | Bacteria | 1858 |
| 100 | Ga0466705_193722 | 3300042612 | Bacteria | 3047 |
| 101 | Ga0466732_370059 | 3300042656 | Bacteria | 2792 |
| 102 | Ga0123353_13218366 | 3300010167 | Bacteria | 523 |
| 103 | Ga0466690_031914 | 3300042590 | Bacteria | 2111 |
| 104 | Ga0466694_069492 | 3300042594 | Bacteria | 12714 |
| 105 | Ga0466694_147546 | 3300042594 | Bacteria | 1843 |
| 106 | Ga0466696_075468 | 3300042596 | Bacteria | 23233 |
| 107 | Ga0466719_287794 | 3300042606 | Bacteria | 1424 |
| 108 | Ga0466722_199244 | 3300042609 | Bacteria | 1029 |
| 109 | Ga0466722_252012 | 3300042609 | Unclassified | 1267 |
| 110 | Ga0466712_115108 | 3300042614 | Bacteria | 1015 |
| 111 | Ga0466715_359903 | 3300042616 | Unclassified | 2647 |
| 112 | Ga0466723_055955 | 3300042618 | Bacteria | 14111 |
| 113 | Ga0466723_277759 | 3300042618 | Bacteria | 6603 |
| 114 | Ga0466726_083220 | 3300042619 | Bacteria | 1020 |
| 115 | Ga0466726_299405 | 3300042619 | Unclassified | 1007 |
| 116 | Ga0466726_411735 | 3300042619 | Bacteria | 1615 |
| 117 | Ga0466728_083465 | 3300042620 | Bacteria | 6232 |
| 118 | Ga0466728_089482 | 3300042620 | Bacteria | 8023 |
| 119 | JGI24698J34947_10065856 | 3300002449 | Bacteria | 1765 |
| 120 | JGI24698J34947_10088639 | 3300002449 | Bacteria | 1427 |
| 121 | JGI24698J34947_10109890 | 3300002449 | Bacteria | 1219 |
| 122 | JGI24698J34947_10121112 | 3300002449 | Unclassified | 1135 |
| 123 | JGI24698J34947_10132348 | 3300002449 | Bacteria | 1064 |
| 124 | Ga0466703_346793 | 3300042636 | Bacteria | 9860 |
| 125 | Ga0466708_046450 | 3300042652 | Bacteria | 3662 |
| 126 | Ga0123354_10175853 | 3300010882 | Bacteria | 2468 |
| 127 | Ga0466694_353901 | 3300042594 | Unclassified | 1089 |
| 128 | Ga0466699_019453 | 3300042597 | Bacteria | 10514 |
| 129 | Ga0466699_063914 | 3300042597 | Bacteria | 1911 |
| 130 | Ga0466711_260410 | 3300042615 | Bacteria | 34066 |
| 131 | Ga0466715_391182 | 3300042616 | Bacteria | 13717 |
| 132 | Ga0466726_099622 | 3300042619 | Bacteria | 1319 |
| 133 | JGI24698J34947_10030595 | 3300002449 | Unclassified | 2838 |
| 134 | Ga0068302_10057279 | 3300005071 | Archaea | 2363 |
| 135 | Ga0466709_409270 | 3300042648 | Bacteria | 8559 |
| 136 | Ga0466708_087931 | 3300042652 | Bacteria | 2074 |
| 137 | Ga0466727_183125 | 3300042655 | Bacteria | 1013 |
| 138 | Ga0123353_10091239 | 3300010167 | Bacteria | 4907 |
| 139 | Ga0466692_180594 | 3300042591 | Bacteria | 2427 |
| 140 | Ga0466692_200360 | 3300042591 | Bacteria | 35434 |
| 141 | Ga0466691_060016 | 3300042593 | Bacteria | 3015 |
| 142 | Ga0466699_103691 | 3300042597 | Bacteria | 17413 |
| 143 | Ga0466699_203925 | 3300042597 | Bacteria | 15219 |
| 144 | Ga0466699_306515 | 3300042597 | Bacteria | 1012 |
| 145 | Ga0466699_411769 | 3300042597 | Bacteria | 2249 |
| 146 | Ga0466719_086676 | 3300042606 | Bacteria | 7760 |
| 147 | Ga0466722_096496 | 3300042609 | Bacteria | 15946 |
| 148 | Ga0466711_263447 | 3300042615 | Bacteria | 1417 |
| 149 | Ga0466715_079163 | 3300042616 | Bacteria | 3802 |
| 150 | Ga0466718_003997 | 3300042617 | Bacteria | 1568 |
| 151 | Ga0466723_110201 | 3300042618 | Bacteria | 7735 |
| 152 | Ga0466728_193052 | 3300042620 | Bacteria | 3398 |
| 153 | Ga0466728_196781 | 3300042620 | Bacteria | 3533 |
| 154 | Ga0466728_198769 | 3300042620 | Bacteria | 2557 |
| 155 | FAAS_10038934 | 3300001880 | Bacteria | 557 |
| 156 | JGI24698J34947_10058320 | 3300002449 | Bacteria | 1912 |
| 157 | JGI24698J34947_10173188 | 3300002449 | Bacteria | 871 |
| 158 | Ga0466735_096331 | 3300042624 | Bacteria | 1498 |
| 159 | Ga0466708_140353 | 3300042652 | Bacteria | 4001 |
| 160 | Ga0264413_101259 | 3300024493 | Bacteria | 11414 |
| 161 | Ga0264413_125951 | 3300024493 | Bacteria | 1845 |
| 162 | Ga0466692_094823 | 3300042591 | Bacteria | 2569 |
| 163 | Ga0466691_038635 | 3300042593 | Bacteria | 3025 |
| 164 | Ga0466694_100808 | 3300042594 | Bacteria | 7330 |
| 165 | Ga0466696_177093 | 3300042596 | Bacteria | 8861 |
| 166 | Ga0466699_057469 | 3300042597 | Bacteria | 6596 |
| 167 | Ga0466699_133028 | 3300042597 | Bacteria | 21739 |
| 168 | Ga0466700_175659 | 3300042600 | Bacteria | 2172 |
| 169 | Ga0466722_040792 | 3300042609 | Bacteria | 3561 |
| 170 | Ga0466722_137852 | 3300042609 | Bacteria | 20935 |
| 171 | Ga0466712_089043 | 3300042614 | Bacteria | 1089 |
| 172 | Ga0466718_041449 | 3300042617 | Bacteria | 1275 |
| 173 | Ga0466723_167658 | 3300042618 | Bacteria | 1788 |
| 174 | JGI24698J34947_10317819 | 3300002449 | Bacteria | 555 |
| 175 | Ga0072941_1135414 | 3300005201 | Bacteria | 1839 |
| 176 | Ga0466703_059612 | 3300042636 | Bacteria | 4883 |
| 177 | Ga0466704_000872 | 3300042643 | Bacteria | 2593 |
| 178 | Ga0466704_080954 | 3300042643 | Bacteria | 11536 |
| 179 | Ga0466709_262981 | 3300042648 | Bacteria | 44599 |
| 180 | Ga0466708_181350 | 3300042652 | Bacteria | 2960 |
| 181 | Ga0466708_264944 | 3300042652 | Bacteria | 11542 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF08218 | GO:0008771 | [citrate (pro-3S)-lyase] ligase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.