Protein Family IF05179
Metagenome
Isolate
170
Members
41
Samples
167
Scaffolds
254.91
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_199837|Ga0466696_199837_137_976
- Length
- 270 aa
- Sequence
- MDNYGAQFKMPEKVLFRRPTGTTGIMIRIILRKLEIIGQYFAFLGEIGRWGVRRPFRFGQYMLEIEHLGVNSVLIIFLSGGAIGMIFALQMVSILQPFQAEVGSRELAPVITTLMLIAKSGSAMAAELGTMRVTEQIDALESMAVSPVHYLVLPKVIASLVVFPVLTLLANVIGTLGAYIISVYLFDIDSASYVDYMFGFLYPRDIITGLIKSALMGIIVATICCFNGLRTSQGAKGVGDSATKAVVASSVTILVADYFMTTLMMSYIYA
Sample Types
Isolate
1.8%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.0%
Kalotermitidae
35.0%
Unclassified
15.0%
Rhinotermitidae
7.5%
Termopsidae
7.5%
Taxonomy
Archaea
2
Bacteria
154
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 7 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 10 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 11 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 17 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 18 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 24 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 30 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 31 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 34 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 35 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 41 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_064507 | 3300042612 | Bacteria | 9210 |
| 2 | Ga0466705_169167 | 3300042612 | Bacteria | 14245 |
| 3 | JGI24695J34938_10001833 | 3300002450 | Bacteria | 17337 |
| 4 | Ga0123356_10003429 | 3300010049 | Bacteria | 16603 |
| 5 | Ga0466690_006391 | 3300042590 | Bacteria | 4056 |
| 6 | Ga0466691_003296 | 3300042593 | Bacteria | 1345 |
| 7 | Ga0466691_183383 | 3300042593 | Bacteria | 8949 |
| 8 | Ga0466691_190313 | 3300042593 | Bacteria | 23453 |
| 9 | Ga0466696_199837 | 3300042596 | Bacteria | 1163 |
| 10 | Ga0466704_222603 | 3300042643 | Bacteria | 60546 |
| 11 | Ga0466709_147740 | 3300042648 | Bacteria | 5306 |
| 12 | Ga0466708_039521 | 3300042652 | Bacteria | 3832 |
| 13 | Ga0466716_293386 | 3300042605 | Bacteria | 1755 |
| 14 | Ga0466719_190747 | 3300042606 | Bacteria | 1945 |
| 15 | Ga0466719_233511 | 3300042606 | Bacteria | 5353 |
| 16 | Ga0466722_027207 | 3300042609 | Bacteria | 6823 |
| 17 | Ga0466711_283817 | 3300042615 | Bacteria | 5209 |
| 18 | Ga0466711_427013 | 3300042615 | Bacteria | 2543 |
| 19 | Ga0466715_608287 | 3300042616 | Bacteria | 12376 |
| 20 | Ga0466723_288045 | 3300042618 | Unclassified | 3998 |
| 21 | Ga0466723_289247 | 3300042618 | Bacteria | 1599 |
| 22 | Ga0466705_101506 | 3300042612 | Bacteria | 2166 |
| 23 | Ga0466732_214169 | 3300042656 | Bacteria | 2564 |
| 24 | JGI24698J34947_10001394 | 3300002449 | Bacteria | 12716 |
| 25 | JGI24702J35022_10057639 | 3300002462 | Bacteria | 2073 |
| 26 | Ga0466690_161821 | 3300042590 | Bacteria | 1525 |
| 27 | Ga0466703_082349 | 3300042636 | Bacteria | 4466 |
| 28 | Ga0466704_045761 | 3300042643 | Bacteria | 13519 |
| 29 | Ga0466709_319031 | 3300042648 | Bacteria | 3659 |
| 30 | Ga0466708_069200 | 3300042652 | Bacteria | 7285 |
| 31 | Ga0466708_111845 | 3300042652 | Bacteria | 5982 |
| 32 | Ga0466708_148083 | 3300042652 | Bacteria | 6634 |
| 33 | Ga0466708_152672 | 3300042652 | Bacteria | 8018 |
| 34 | Ga0466700_350038 | 3300042600 | Bacteria | 1906 |
| 35 | Ga0466719_163858 | 3300042606 | Unclassified | 5824 |
| 36 | Ga0466719_245337 | 3300042606 | Bacteria | 2487 |
| 37 | Ga0466719_386768 | 3300042606 | Bacteria | 5527 |
| 38 | Ga0466719_425308 | 3300042606 | Bacteria | 1003 |
| 39 | Ga0466705_432689 | 3300042612 | Bacteria | 11828 |
| 40 | Ga0466712_124444 | 3300042614 | Bacteria | 16631 |
| 41 | Ga0466712_165211 | 3300042614 | Bacteria | 10653 |
| 42 | Ga0466715_226935 | 3300042616 | Unclassified | 4021 |
| 43 | Ga0466715_465901 | 3300042616 | Bacteria | 11392 |
| 44 | Ga0466715_517254 | 3300042616 | Bacteria | 19210 |
| 45 | Ga0466728_005187 | 3300042620 | Bacteria | 1884 |
| 46 | Ga0466705_223816 | 3300042612 | Bacteria | 2543 |
| 47 | Ga0466705_257279 | 3300042612 | Bacteria | 4517 |
| 48 | Ga0466705_369611 | 3300042612 | Bacteria | 5074 |
| 49 | Ga0466733_190241 | 3300042659 | Bacteria | 1328 |
| 50 | AustNasuHG_c1026863 | 3300000089 | Unclassified | 1781 |
| 51 | JGI24698J34947_10012075 | 3300002449 | Unclassified | 4739 |
| 52 | Ga0466690_312023 | 3300042590 | Unclassified | 2695 |
| 53 | Ga0466692_027188 | 3300042591 | Bacteria | 5328 |
| 54 | Ga0466691_188503 | 3300042593 | Bacteria | 2430 |
| 55 | Ga0466702_417103 | 3300042635 | Bacteria | 1159 |
| 56 | Ga0466703_188679 | 3300042636 | Bacteria | 4037 |
| 57 | Ga0466703_299713 | 3300042636 | Bacteria | 4632 |
| 58 | Ga0466704_071097 | 3300042643 | Bacteria | 5110 |
| 59 | Ga0466708_304447 | 3300042652 | Bacteria | 6402 |
| 60 | Ga0466707_213830 | 3300042601 | Bacteria | 8802 |
| 61 | Ga0466716_116925 | 3300042605 | Unclassified | 2469 |
| 62 | Ga0466719_479880 | 3300042606 | Bacteria | 1837 |
| 63 | Ga0466712_259714 | 3300042614 | Unclassified | 7027 |
| 64 | Ga0466705_067513 | 3300042612 | Bacteria | 4785 |
| 65 | JGI24698J34947_10005839 | 3300002449 | Bacteria | 6747 |
| 66 | Ga0068305_10329338 | 3300005083 | Bacteria | 27771 |
| 67 | Ga0466690_162050 | 3300042590 | Unclassified | 7411 |
| 68 | Ga0466692_172451 | 3300042591 | Bacteria | 2037 |
| 69 | Ga0466709_124918 | 3300042648 | Bacteria | 1946 |
| 70 | Ga0466709_416555 | 3300042648 | Bacteria | 26652 |
| 71 | Ga0466713_010501 | 3300042602 | Bacteria | 5262 |
| 72 | Ga0466716_383727 | 3300042605 | Bacteria | 2346 |
| 73 | Ga0466716_472724 | 3300042605 | Unclassified | 2783 |
| 74 | Ga0466719_070401 | 3300042606 | Bacteria | 7337 |
| 75 | Ga0466719_282108 | 3300042606 | Bacteria | 4927 |
| 76 | Ga0466722_245291 | 3300042609 | Bacteria | 1235 |
| 77 | Ga0466705_484739 | 3300042612 | Bacteria | 6747 |
| 78 | Ga0466712_210370 | 3300042614 | Bacteria | 7978 |
| 79 | Ga0466711_016433 | 3300042615 | Bacteria | 3765 |
| 80 | Ga0466711_409386 | 3300042615 | Bacteria | 2098 |
| 81 | Ga0466715_110720 | 3300042616 | Bacteria | 1749 |
| 82 | Ga0466705_102688 | 3300042612 | Bacteria | 17173 |
| 83 | Ga0123357_10349105 | 3300009784 | Bacteria | 1418 |
| 84 | Ga0123353_10178050 | 3300010167 | Bacteria | 3369 |
| 85 | Ga0466690_080350 | 3300042590 | Bacteria | 2055 |
| 86 | Ga0466692_155244 | 3300042591 | Bacteria | 3147 |
| 87 | Ga0466695_290770 | 3300042595 | Bacteria | 97007 |
| 88 | Ga0466735_188562 | 3300042624 | Bacteria | 3711 |
| 89 | Ga0466703_389215 | 3300042636 | Bacteria | 42403 |
| 90 | Ga0466704_247867 | 3300042643 | Bacteria | 8426 |
| 91 | Ga0466709_399580 | 3300042648 | Bacteria | 1364 |
| 92 | Ga0466727_092408 | 3300042655 | Bacteria | 21730 |
| 93 | Ga0466700_034176 | 3300042600 | Bacteria | 1100 |
| 94 | Ga0466715_124780 | 3300042616 | Bacteria | 3761 |
| 95 | Ga0466715_643304 | 3300042616 | Bacteria | 2190 |
| 96 | Ga0466723_277967 | 3300042618 | Bacteria | 29515 |
| 97 | Ga0466726_242568 | 3300042619 | Bacteria | 1263 |
| 98 | Ga0466728_207263 | 3300042620 | Bacteria | 13163 |
| 99 | AustNasuHG_c1001135 | 3300000089 | Bacteria | 9596 |
| 100 | Ga0123356_10253240 | 3300010049 | Bacteria | 1840 |
| 101 | Ga0123353_10702931 | 3300010167 | Bacteria | 1418 |
| 102 | Ga0415639_022751 | 3300038395 | Bacteria | 7862 |
| 103 | Ga0466690_041598 | 3300042590 | Bacteria | 2052 |
| 104 | Ga0466691_036978 | 3300042593 | Bacteria | 4260 |
| 105 | Ga0466696_020920 | 3300042596 | Bacteria | 1347 |
| 106 | Ga0466696_300246 | 3300042596 | Bacteria | 7689 |
| 107 | Ga0466704_140302 | 3300042643 | Bacteria | 3256 |
| 108 | Ga0466709_193696 | 3300042648 | Bacteria | 3024 |
| 109 | Ga0466708_419574 | 3300042652 | Bacteria | 2156 |
| 110 | Ga0466727_017951 | 3300042655 | Bacteria | 1518 |
| 111 | Ga0466719_144585 | 3300042606 | Bacteria | 1551 |
| 112 | Ga0466712_132994 | 3300042614 | Bacteria | 8420 |
| 113 | Ga0466712_237658 | 3300042614 | Bacteria | 1849 |
| 114 | Ga0466715_603655 | 3300042616 | Bacteria | 10375 |
| 115 | Ga0466723_064254 | 3300042618 | Bacteria | 3007 |
| 116 | Ga0466723_365336 | 3300042618 | Bacteria | 6225 |
| 117 | Ga0466728_231640 | 3300042620 | Bacteria | 9106 |
| 118 | Ga0466728_460005 | 3300042620 | Bacteria | 5101 |
| 119 | Ga0466728_479190 | 3300042620 | Bacteria | 5459 |
| 120 | Ga0466705_081280 | 3300042612 | Bacteria | 4170 |
| 121 | Ga0123353_10732535 | 3300010167 | Bacteria | 1380 |
| 122 | Ga0466691_107192 | 3300042593 | Archaea | 5682 |
| 123 | Ga0466696_299063 | 3300042596 | Unclassified | 3544 |
| 124 | Ga0466703_219512 | 3300042636 | Bacteria | 6405 |
| 125 | Ga0466704_284658 | 3300042643 | Unclassified | 3784 |
| 126 | Ga0466708_101543 | 3300042652 | Bacteria | 4098 |
| 127 | Ga0466700_270658 | 3300042600 | Bacteria | 2752 |
| 128 | Ga0466722_088142 | 3300042609 | Bacteria | 11867 |
| 129 | Ga0466711_312387 | 3300042615 | Bacteria | 16329 |
| 130 | Ga0466711_502192 | 3300042615 | Bacteria | 57733 |
| 131 | Ga0466715_125435 | 3300042616 | Bacteria | 7867 |
| 132 | Ga0466723_194510 | 3300042618 | Bacteria | 2938 |
| 133 | Ga0466723_243588 | 3300042618 | Bacteria | 2139 |
| 134 | Ga0466723_271952 | 3300042618 | Bacteria | 4843 |
| 135 | Ga0466729_093582 | 3300042621 | Bacteria | 2067 |
| 136 | Ga0466705_237477 | 3300042612 | Bacteria | 4397 |
| 137 | JGI24698J34947_10016725 | 3300002449 | Bacteria | 3980 |
| 138 | JGI24698J34947_10064549 | 3300002449 | Bacteria | 1789 |
| 139 | Ga0072941_1105486 | 3300005201 | Bacteria | 3715 |
| 140 | Ga0466690_067040 | 3300042590 | Bacteria | 5015 |
| 141 | Ga0466692_068566 | 3300042591 | Bacteria | 34048 |
| 142 | Ga0466691_001092 | 3300042593 | Bacteria | 4654 |
| 143 | Ga0466691_057110 | 3300042593 | Unclassified | 7496 |
| 144 | Ga0466696_163279 | 3300042596 | Archaea | 4437 |
| 145 | Ga0466696_224145 | 3300042596 | Bacteria | 4592 |
| 146 | Ga0466703_243387 | 3300042636 | Bacteria | 2892 |
| 147 | Ga0466704_054474 | 3300042643 | Bacteria | 6087 |
| 148 | Ga0466704_068798 | 3300042643 | Bacteria | 3237 |
| 149 | Ga0466709_086523 | 3300042648 | Bacteria | 29803 |
| 150 | Ga0466708_047204 | 3300042652 | Bacteria | 3879 |
| 151 | Ga0466708_085438 | 3300042652 | Bacteria | 3391 |
| 152 | Ga0466708_120110 | 3300042652 | Bacteria | 21676 |
| 153 | Ga0466708_221722 | 3300042652 | Bacteria | 4437 |
| 154 | Ga0466713_089332 | 3300042602 | Bacteria | 1319 |
| 155 | Ga0466716_193208 | 3300042605 | Bacteria | 2745 |
| 156 | Ga0466716_268122 | 3300042605 | Bacteria | 5347 |
| 157 | Ga0466716_467705 | 3300042605 | Bacteria | 8879 |
| 158 | Ga0466719_104575 | 3300042606 | Unclassified | 1358 |
| 159 | Ga0466719_204308 | 3300042606 | Bacteria | 18675 |
| 160 | Ga0466711_018972 | 3300042615 | Bacteria | 12437 |
| 161 | Ga0466711_135095 | 3300042615 | Bacteria | 1427 |
| 162 | Ga0466715_280038 | 3300042616 | Bacteria | 6744 |
| 163 | Ga0466723_030944 | 3300042618 | Bacteria | 8107 |
| 164 | Ga0466723_088040 | 3300042618 | Bacteria | 3074 |
| 165 | Ga0466728_164294 | 3300042620 | Bacteria | 24802 |
| 166 | Ga0466728_242664 | 3300042620 | Bacteria | 3562 |
| 167 | Ga0466728_249752 | 3300042620 | Bacteria | 11343 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02405 | MlaE | Permease MlaE | 64 | 262 | 0.98 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02405 | GO:0043190 | ATP-binding cassette (ABC) transporter complex | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.