Protein Family IF05161

Metagenome
141 Members
39 Samples
141 Scaffolds
97.52 Avg Length

🧬 Representative Sequence

ID
3300042596|Ga0466696_168168|Ga0466696_168168_520_876
Length
118 aa
Sequence
MLLDKTPYNFLHRHPWRKAGKMGKVFKGQSALRIRVKTFTDLEGIDSASIKYRKPDGAWGEFSAGVSDTVKGVIFHECIEGELDIAGWWVFWAFITFADGRTAAGEAAKVFIWNEGSG

📊 Sample Types

Isolate 0.0%
Metagenome 100.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 50.0%
Kalotermitidae 34.2%
Termopsidae 10.5%
Unclassified 2.6%
Rhinotermitidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 132
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
3 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
4 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
5 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
6 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
7 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
8 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
9 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
10 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
11 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
12 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
13 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
14 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
15 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
16 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
17 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
18 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
19 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
20 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
24 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
25 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
26 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
27 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
28 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
29 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
30 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
31 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
32 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
33 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
34 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
35 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466691_176974 3300042593 Bacteria 4171
2 Ga0466712_184277 3300042614 Bacteria 3385
3 Ga0466712_184730 3300042614 Bacteria 2994
4 Ga0466715_106902 3300042616 Unclassified 5117
5 Ga0466731_022274 3300042622 Unclassified 1300
6 Ga0466735_002801 3300042624 Bacteria 1769
7 Ga0466704_085883 3300042643 Bacteria 13794
8 Ga0466708_102219 3300042652 Unclassified 5997
9 Ga0466708_352059 3300042652 Unclassified 2534
10 Ga0466727_180001 3300042655 Bacteria 1132
11 Ga0466714_126247 3300042603 Bacteria 1165
12 Ga0466717_263245 3300042604 Bacteria 1151
13 Ga0466717_297809 3300042604 Bacteria 1242
14 Ga0466705_380732 3300042612 Bacteria 1095
15 JGI24698J34947_10057273 3300002449 Bacteria 1934
16 JGI24702J35022_10025439 3300002462 Bacteria 3195
17 Ga0072941_1010301 3300005201 Bacteria 11646
18 Ga0466696_168168 3300042596 Bacteria 1764
19 Ga0466705_500389 3300042612 Bacteria 2990
20 Ga0466712_086445 3300042614 Bacteria 4390
21 Ga0466715_031499 3300042616 Bacteria 4521
22 Ga0466715_179960 3300042616 Bacteria 1380
23 Ga0466715_420817 3300042616 Bacteria 4415
24 Ga0466728_184144 3300042620 Bacteria 1295
25 Ga0123354_10462235 3300010882 Bacteria 1018
26 Ga0466731_247471 3300042622 Bacteria 1040
27 Ga0466731_247886 3300042622 Bacteria 1514
28 Ga0466704_525907 3300042643 Unclassified 3755
29 Ga0466708_143595 3300042652 Bacteria 36906
30 Ga0466727_254991 3300042655 Bacteria 2830
31 Ga0466733_113191 3300042659 Bacteria 3994
32 JGI24698J34947_10024343 3300002449 Bacteria 3233
33 JGI24698J34947_10058826 3300002449 Bacteria 1902
34 JGI24698J34947_10119863 3300002449 Bacteria 1144
35 JGI24698J34947_10124360 3300002449 Bacteria 1113
36 JGI24698J34947_10153576 3300002449 Bacteria 952
37 JGI24698J34947_10178933 3300002449 Bacteria 850
38 Ga0466712_305882 3300042614 Bacteria 5498
39 Ga0466715_478575 3300042616 Bacteria 1049
40 Ga0466728_417262 3300042620 Bacteria 1676
41 Ga0466729_075485 3300042621 Bacteria 3588
42 Ga0123356_10201273 3300010049 Unclassified 2031
43 Ga0123353_10235512 3300010167 Bacteria 2850
44 Ga0123354_10536149 3300010882 Bacteria 891
45 Ga0466703_052559 3300042636 Bacteria 1545
46 Ga0466704_230361 3300042643 Bacteria 1015
47 Ga0466704_482486 3300042643 Bacteria 1146
48 Ga0466709_155647 3300042648 Bacteria 9239
49 Ga0466708_037525 3300042652 Bacteria 5796
50 Ga0466727_296704 3300042655 Bacteria 2221
51 Ga0466716_223059 3300042605 Bacteria 6138
52 Ga0466719_000996 3300042606 Bacteria 4167
53 Ga0466719_142809 3300042606 Bacteria 2300
54 Ga0466719_181010 3300042606 Bacteria 14792
55 Ga0466698_276857 3300042610 Bacteria 2019
56 Ga0466705_132994 3300042612 Bacteria 2604
57 JGI24698J34947_10003901 3300002449 Bacteria 8112
58 JGI24698J34947_10047392 3300002449 Bacteria 2181
59 Ga0072940_1037364 3300005200 Bacteria 3924
60 Ga0466694_233848 3300042594 Bacteria 3158
61 Ga0466718_009395 3300042617 Bacteria 3498
62 Ga0466726_257189 3300042619 Bacteria 16905
63 Ga0466728_250213 3300042620 Bacteria 1248
64 Ga0466709_098477 3300042648 Bacteria 2799
65 Ga0466727_136960 3300042655 Bacteria 5080
66 Ga0466707_010469 3300042601 Bacteria 1080
67 Ga0466719_086548 3300042606 Bacteria 4003
68 Ga0466719_105623 3300042606 Bacteria 4594
69 Ga0466705_118869 3300042612 Bacteria 9595
70 Ga0466733_135367 3300042659 Bacteria 1594
71 JGI24698J34947_10015130 3300002449 Bacteria 4201
72 JGI24698J34947_10032549 3300002449 Bacteria 2737
73 JGI24698J34947_10032948 3300002449 Bacteria 2719
74 JGI24698J34947_10162614 3300002449 Bacteria 913
75 JGI24702J35022_10031356 3300002462 Bacteria 2849
76 Ga0466712_041980 3300042614 Bacteria 2302
77 Ga0466712_070276 3300042614 Bacteria 1047
78 Ga0466715_119492 3300042616 Bacteria 4072
79 Ga0466723_193491 3300042618 Bacteria 4818
80 Ga0466728_196720 3300042620 Bacteria 1047
81 Ga0123356_11788100 3300010049 Bacteria 764
82 Ga0123353_10513929 3300010167 Bacteria 1740
83 Ga0466703_016037 3300042636 Bacteria 2606
84 Ga0466703_363576 3300042636 Bacteria 1772
85 Ga0466704_142408 3300042643 Bacteria 1437
86 Ga0466708_008949 3300042652 Bacteria 4146
87 Ga0466708_177478 3300042652 Unclassified 2339
88 Ga0466719_039397 3300042606 Bacteria 3066
89 Ga0466719_132084 3300042606 Bacteria 1665
90 Ga0466698_197205 3300042610 Bacteria 2681
91 Ga0466698_246634 3300042610 Bacteria 4349
92 Ga0466705_330923 3300042612 Bacteria 1451
93 JGI24698J34947_10008756 3300002449 Bacteria 5550
94 JGI24698J34947_10304469 3300002449 Unclassified 573
95 Ga0072941_1097192 3300005201 Bacteria 4198
96 Ga0466694_288461 3300042594 Bacteria 3768
97 Ga0466712_015006 3300042614 Bacteria 6605
98 Ga0466715_225207 3300042616 Bacteria 4215
99 Ga0466723_360056 3300042618 Bacteria 17116
100 Ga0466726_019051 3300042619 Bacteria 2543
101 Ga0466726_212784 3300042619 Bacteria 4293
102 Ga0466729_050437 3300042621 Bacteria 1087
103 Ga0123353_10662375 3300010167 Bacteria 1475
104 Ga0466731_079200 3300042622 Bacteria 1562
105 Ga0466704_378094 3300042643 Unclassified 3379
106 Ga0466709_330620 3300042648 Bacteria 12430
107 Ga0466708_244360 3300042652 Bacteria 2012
108 Ga0466725_453782 3300042654 Bacteria 1143
109 Ga0466719_029594 3300042606 Bacteria 1478
110 JGI24695J34938_10018754 3300002450 Bacteria 3448
111 Ga0466690_414683 3300042590 Bacteria 2060
112 Ga0466696_253398 3300042596 Bacteria 2765
113 Ga0466705_408284 3300042612 Bacteria 1028
114 Ga0466715_042567 3300042616 Bacteria 1938
115 Ga0466715_316100 3300042616 Bacteria 8443
116 Ga0466723_038134 3300042618 Bacteria 1667
117 Ga0466723_098824 3300042618 Bacteria 7039
118 Ga0466723_225429 3300042618 Bacteria 1001
119 Ga0466728_274693 3300042620 Bacteria 2508
120 Ga0123356_10054929 3300010049 Bacteria 3709
121 Ga0123353_12904250 3300010167 Bacteria 558
122 Ga0466731_246761 3300042622 Bacteria 1090
123 Ga0466734_028262 3300042623 Bacteria 1470
124 Ga0466704_356508 3300042643 Bacteria 2688
125 Ga0466707_121087 3300042601 Bacteria 2585
126 Ga0466707_209193 3300042601 Bacteria 1759
127 JGI24695J34938_10011885 3300002450 Bacteria 4654
128 Ga0068302_10059392 3300005071 Bacteria 1147
129 Ga0072941_1187702 3300005201 Bacteria 1629
130 Ga0466690_022704 3300042590 Bacteria 8648
131 Ga0466705_513027 3300042612 Bacteria 1621
132 Ga0466712_190293 3300042614 Bacteria 1704
133 Ga0466723_092507 3300042618 Bacteria 4517
134 Ga0466723_216106 3300042618 Bacteria 4688
135 Ga0466723_232472 3300042618 Bacteria 4395
136 Ga0466729_103859 3300042621 Bacteria 1190
137 Ga0466729_182246 3300042621 Bacteria 1515
138 Ga0123357_10368257 3300009784 Bacteria 1350
139 Ga0466702_456193 3300042635 Bacteria 1681
140 Ga0466708_158696 3300042652 Bacteria 1031
141 Ga0466719_113697 3300042606 Bacteria 2353

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042596 Ga0466696_253398 Ga0466696_253398_2293_2580 95
2 3300042652 Ga0466708_143595 Ga0466708_143595_36385_36672 95
3 3300042594 Ga0466694_288461 Ga0466694_288461_2986_3276 96
4 3300042601 Ga0466707_121087 Ga0466707_121087_35_325 96
5 3300042601 Ga0466707_209193 Ga0466707_209193_1285_1575 96
6 3300042604 Ga0466717_297809 Ga0466717_297809_805_1095 96
7 3300042606 Ga0466719_000996 Ga0466719_000996_807_1097 96
8 3300042610 Ga0466698_197205 Ga0466698_197205_839_1129 96
9 3300042610 Ga0466698_246634 Ga0466698_246634_3628_3918 96
10 3300042612 Ga0466705_118869 Ga0466705_118869_6966_7256 96
11 3300042612 Ga0466705_132994 Ga0466705_132994_2060_2350 96
12 3300042612 Ga0466705_380732 Ga0466705_380732_318_608 96
13 3300042612 Ga0466705_500389 Ga0466705_500389_419_709 96
14 3300042614 Ga0466712_070276 Ga0466712_070276_606_896 96
15 3300042614 Ga0466712_086445 Ga0466712_086445_192_482 96
16 3300042614 Ga0466712_184730 Ga0466712_184730_1970_2260 96
17 3300042616 Ga0466715_420817 Ga0466715_420817_1110_1400 96
18 3300042616 Ga0466715_478575 Ga0466715_478575_685_975 96
19 3300042617 Ga0466718_009395 Ga0466718_009395_2991_3281 96
20 3300042618 Ga0466723_216106 Ga0466723_216106_1375_1665 96
21 3300042620 Ga0466728_184144 Ga0466728_184144_301_591 96
22 3300042620 Ga0466728_274693 Ga0466728_274693_1473_1763 96
23 3300042621 Ga0466729_050437 Ga0466729_050437_62_352 96
24 3300042621 Ga0466729_075485 Ga0466729_075485_2857_3147 96
25 3300042621 Ga0466729_182246 Ga0466729_182246_1054_1344 96
26 3300042622 Ga0466731_022274 Ga0466731_022274_35_325 96
27 3300042622 Ga0466731_246761 Ga0466731_246761_612_902 96
28 3300042622 Ga0466731_247471 Ga0466731_247471_140_430 96
29 3300042635 Ga0466702_456193 Ga0466702_456193_422_712 96
30 3300042636 Ga0466703_016037 Ga0466703_016037_1901_2191 96
31 3300042643 Ga0466704_482486 Ga0466704_482486_682_972 96
32 3300042648 Ga0466709_330620 Ga0466709_330620_3872_4162 96
33 3300042654 Ga0466725_453782 Ga0466725_453782_555_845 96
34 3300042655 Ga0466727_254991 Ga0466727_254991_376_666 96
35 3300002449 JGI24698J34947_10008756 JGI24698J34947_100087565 97
36 3300002449 JGI24698J34947_10024343 JGI24698J34947_100243433 97
37 3300002449 JGI24698J34947_10032549 JGI24698J34947_100325492 97
38 3300002449 JGI24698J34947_10032948 JGI24698J34947_100329483 97
39 3300002449 JGI24698J34947_10058826 JGI24698J34947_100588263 97
40 3300002449 JGI24698J34947_10124360 JGI24698J34947_101243602 97
41 3300002449 JGI24698J34947_10153576 JGI24698J34947_101535763 97
42 3300002449 JGI24698J34947_10178933 JGI24698J34947_101789332 97
43 3300002450 JGI24695J34938_10011885 JGI24695J34938_100118856 97
44 3300002462 JGI24702J35022_10025439 JGI24702J35022_100254392 97
45 3300002462 JGI24702J35022_10031356 JGI24702J35022_100313563 97
46 3300005200 Ga0072940_1037364 Ga0072940_10373643 97
47 3300005201 Ga0072941_1010301 Ga0072941_101030114 97
48 3300005201 Ga0072941_1097192 Ga0072941_10971923 97
49 3300005201 Ga0072941_1187702 Ga0072941_11877022 97
50 3300010167 Ga0123353_10235512 Ga0123353_102355123 97
51 3300042590 Ga0466690_022704 Ga0466690_022704_8107_8400 97
52 3300042590 Ga0466690_414683 Ga0466690_414683_223_516 97
53 3300042593 Ga0466691_176974 Ga0466691_176974_526_819 97
54 3300042594 Ga0466694_233848 Ga0466694_233848_1408_1701 97
55 3300042601 Ga0466707_010469 Ga0466707_010469_249_542 97
56 3300042603 Ga0466714_126247 Ga0466714_126247_463_756 97
57 3300042604 Ga0466717_263245 Ga0466717_263245_457_750 97
58 3300042605 Ga0466716_223059 Ga0466716_223059_4871_5164 97
59 3300042606 Ga0466719_039397 Ga0466719_039397_1824_2117 97
60 3300042606 Ga0466719_086548 Ga0466719_086548_1730_2023 97
61 3300042606 Ga0466719_105623 Ga0466719_105623_579_872 97
62 3300042606 Ga0466719_113697 Ga0466719_113697_282_575 97
63 3300042606 Ga0466719_132084 Ga0466719_132084_326_619 97
64 3300042606 Ga0466719_181010 Ga0466719_181010_13429_13722 97
65 3300042610 Ga0466698_276857 Ga0466698_276857_311_604 97
66 3300042612 Ga0466705_330923 Ga0466705_330923_240_533 97
67 3300042612 Ga0466705_408284 Ga0466705_408284_57_350 97
68 3300042612 Ga0466705_513027 Ga0466705_513027_97_390 97
69 3300042614 Ga0466712_015006 Ga0466712_015006_2981_3274 97
70 3300042614 Ga0466712_041980 Ga0466712_041980_21_314 97
71 3300042614 Ga0466712_184277 Ga0466712_184277_1535_1828 97
72 3300042614 Ga0466712_190293 Ga0466712_190293_647_940 97
73 3300042614 Ga0466712_305882 Ga0466712_305882_4191_4484 97
74 3300042616 Ga0466715_031499 Ga0466715_031499_572_865 97
75 3300042616 Ga0466715_042567 Ga0466715_042567_218_511 97
76 3300042616 Ga0466715_106902 Ga0466715_106902_4700_4993 97
77 3300042616 Ga0466715_119492 Ga0466715_119492_3284_3577 97
78 3300042616 Ga0466715_179960 Ga0466715_179960_775_1068 97
79 3300042616 Ga0466715_225207 Ga0466715_225207_3798_4091 97
80 3300042616 Ga0466715_316100 Ga0466715_316100_2373_2666 97
81 3300042618 Ga0466723_038134 Ga0466723_038134_894_1187 97
82 3300042618 Ga0466723_092507 Ga0466723_092507_1449_1742 97
83 3300042618 Ga0466723_098824 Ga0466723_098824_3117_3410 97
84 3300042618 Ga0466723_232472 Ga0466723_232472_749_1042 97
85 3300042618 Ga0466723_360056 Ga0466723_360056_2514_2807 97
86 3300042619 Ga0466726_212784 Ga0466726_212784_1726_2019 97
87 3300042619 Ga0466726_257189 Ga0466726_257189_272_565 97
88 3300042620 Ga0466728_196720 Ga0466728_196720_203_496 97
89 3300042620 Ga0466728_250213 Ga0466728_250213_218_511 97
90 3300042620 Ga0466728_417262 Ga0466728_417262_1078_1371 97
91 3300042621 Ga0466729_103859 Ga0466729_103859_466_759 97
92 3300042622 Ga0466731_079200 Ga0466731_079200_1134_1427 97
93 3300042623 Ga0466734_028262 Ga0466734_028262_1074_1367 97
94 3300042636 Ga0466703_052559 Ga0466703_052559_681_974 97
95 3300042636 Ga0466703_363576 Ga0466703_363576_232_525 97
96 3300042643 Ga0466704_085883 Ga0466704_085883_11810_12103 97
97 3300042643 Ga0466704_142408 Ga0466704_142408_356_649 97
98 3300042643 Ga0466704_230361 Ga0466704_230361_324_617 97
99 3300042643 Ga0466704_356508 Ga0466704_356508_550_843 97
100 3300042643 Ga0466704_378094 Ga0466704_378094_61_354 97
101 3300042643 Ga0466704_525907 Ga0466704_525907_453_746 97
102 3300042648 Ga0466709_155647 Ga0466709_155647_1227_1520 97
103 3300042652 Ga0466708_008949 Ga0466708_008949_317_610 97
104 3300042652 Ga0466708_102219 Ga0466708_102219_4646_4939 97
105 3300042652 Ga0466708_158696 Ga0466708_158696_440_733 97
106 3300042652 Ga0466708_177478 Ga0466708_177478_13_306 97
107 3300042652 Ga0466708_244360 Ga0466708_244360_1303_1596 97
108 3300042652 Ga0466708_352059 Ga0466708_352059_1994_2287 97
109 3300042655 Ga0466727_136960 Ga0466727_136960_2722_3015 97
110 3300042655 Ga0466727_180001 Ga0466727_180001_496_789 97
111 3300042655 Ga0466727_296704 Ga0466727_296704_376_669 97
112 3300042659 Ga0466733_113191 Ga0466733_113191_3038_3331 97
113 3300042659 Ga0466733_135367 Ga0466733_135367_1035_1328 97
114 3300002449 JGI24698J34947_10003901 JGI24698J34947_100039012 98
115 3300002449 JGI24698J34947_10015130 JGI24698J34947_100151303 98
116 3300002449 JGI24698J34947_10047392 JGI24698J34947_100473923 98
117 3300002449 JGI24698J34947_10057273 JGI24698J34947_100572733 98
118 3300002449 JGI24698J34947_10119863 JGI24698J34947_101198632 98
119 3300002449 JGI24698J34947_10162614 JGI24698J34947_101626142 98
120 3300002449 JGI24698J34947_10304469 JGI24698J34947_103044692 98
121 3300002450 JGI24695J34938_10018754 JGI24695J34938_100187543 98
122 3300005071 Ga0068302_10059392 Ga0068302_100593922 98
123 3300009784 Ga0123357_10368257 Ga0123357_103682572 98
124 3300010049 Ga0123356_10054929 Ga0123356_100549297 98
125 3300010049 Ga0123356_10201273 Ga0123356_102012733 98
126 3300010049 Ga0123356_11788100 Ga0123356_117881001 98
127 3300010167 Ga0123353_10513929 Ga0123353_105139293 98
128 3300010167 Ga0123353_10662375 Ga0123353_106623752 98
129 3300010167 Ga0123353_12904250 Ga0123353_129042501 98
130 3300010882 Ga0123354_10462235 Ga0123354_104622352 98
131 3300010882 Ga0123354_10536149 Ga0123354_105361493 98
132 3300042618 Ga0466723_193491 Ga0466723_193491_4271_4567 98
133 3300042618 Ga0466723_225429 Ga0466723_225429_481_777 98
134 3300042606 Ga0466719_142809 Ga0466719_142809_745_1050 101
135 3300042648 Ga0466709_098477 Ga0466709_098477_127_435 102
136 3300042652 Ga0466708_037525 Ga0466708_037525_2612_2920 102
137 3300042624 Ga0466735_002801 Ga0466735_002801_947_1270 107
138 3300042606 Ga0466719_029594 Ga0466719_029594_581_916 111
139 3300042619 Ga0466726_019051 Ga0466726_019051_1947_2285 112
140 3300042622 Ga0466731_247886 Ga0466731_247886_1084_1425 113
141 3300042596 Ga0466696_168168 Ga0466696_168168_520_876 118

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.74 0.83 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.