Protein Family IF05149
Metagenome
Isolate
151
Members
44
Samples
149
Scaffolds
417.6
Avg Length
Representative Sequence
- ID
- 3300042596|Ga0466696_129657|Ga0466696_129657_8442_9914
- Length
- 490 aa
- Sequence
- LRQLQPTGYYKFHVPPFSFAPGLLLSPGFFCGCSKIRRFWAAALVYLTFFVYNNGGGETIVAFIRASSEVFMAEEQRDFKSIIQLDSELNQIQDLDLLLERILFEARKVVHADAGSIYVKEKCAEEGGKQVEKLVIKYAQNDTTQKELPPGQKMIYSVFSVPIDEKTISGYCAFTKNLVNIPDAYAIPPDAPYSFGDRYDKISGYRTTSVLAIPLVASEGRLLGVIQVINSKGRDGNTVPFSADDELLFTHFAANAAAALERAYITRAMILRMIKMSELRDPKETGSHVNRVAGYAVEIYDRWAYHHHVAKTEQEKFRDDLKIAAMLHDVGKVAISDVILKKPGRFTPGEYLIMQHHTIYGAALFDDPQSALDLIARDIALTHHENWDGTGYPGWIDPLTQEPIRAGENGKALGRKGEEIPLGGRIVAIADVFDALCSRRVYKEPWSEEQVLAEIRQLSDTKFDPDLVDIFFEILPSIKQIQSLYPEAAD
Sample Types
Isolate
1.3%
Metagenome
98.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.6%
Kalotermitidae
33.3%
Unclassified
7.1%
Termopsidae
7.1%
Rhinotermitidae
4.8%
Taxonomy
Archaea
0
Bacteria
149
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 12 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 13 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 14 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 15 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 16 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 34 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 35 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 36 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 37 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 43 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_216081 | 3300042612 | Bacteria | 5107 |
| 2 | Ga0466705_267853 | 3300042612 | Bacteria | 2529 |
| 3 | Ga0466704_168830 | 3300042643 | Bacteria | 7731 |
| 4 | Ga0466709_257902 | 3300042648 | Bacteria | 5857 |
| 5 | Ga0466708_097904 | 3300042652 | Bacteria | 41312 |
| 6 | Ga0466708_230165 | 3300042652 | Bacteria | 4482 |
| 7 | Ga0466727_345077 | 3300042655 | Bacteria | 5699 |
| 8 | JGI24698J34947_10026222 | 3300002449 | Bacteria | 3098 |
| 9 | JGI24698J34947_10075346 | 3300002449 | Bacteria | 1604 |
| 10 | Ga0072941_1053271 | 3300005201 | Bacteria | 5687 |
| 11 | Ga0466726_235901 | 3300042619 | Bacteria | 2664 |
| 12 | Ga0466728_196724 | 3300042620 | Bacteria | 10642 |
| 13 | Ga0264413_108521 | 3300024493 | Bacteria | 12180 |
| 14 | Ga0466690_253383 | 3300042590 | Bacteria | 3775 |
| 15 | Ga0466692_058159 | 3300042591 | Bacteria | 2220 |
| 16 | Ga0466696_288483 | 3300042596 | Bacteria | 26421 |
| 17 | Ga0466700_181713 | 3300042600 | Bacteria | 63326 |
| 18 | Ga0466719_041739 | 3300042606 | Bacteria | 6726 |
| 19 | Ga0466720_122048 | 3300042607 | Unclassified | 2415 |
| 20 | Ga0466733_094176 | 3300042659 | Bacteria | 8921 |
| 21 | Ga0466704_083910 | 3300042643 | Bacteria | 12895 |
| 22 | JGI24698J34947_10005060 | 3300002449 | Bacteria | 7223 |
| 23 | JGI24698J34947_10027483 | 3300002449 | Bacteria | 3018 |
| 24 | JGI24695J34938_10003105 | 3300002450 | Bacteria | 11870 |
| 25 | JGI24702J35022_10002824 | 3300002462 | Bacteria | 10527 |
| 26 | Ga0466712_056070 | 3300042614 | Bacteria | 8391 |
| 27 | Ga0466712_066563 | 3300042614 | Bacteria | 10732 |
| 28 | Ga0264413_110914 | 3300024493 | Bacteria | 4251 |
| 29 | Ga0466691_005244 | 3300042593 | Bacteria | 8739 |
| 30 | Ga0466691_059914 | 3300042593 | Bacteria | 14735 |
| 31 | Ga0466691_132757 | 3300042593 | Bacteria | 16814 |
| 32 | Ga0466694_049035 | 3300042594 | Bacteria | 10888 |
| 33 | Ga0466696_105780 | 3300042596 | Bacteria | 1985 |
| 34 | Ga0466699_301575 | 3300042597 | Bacteria | 8866 |
| 35 | Ga0466717_184615 | 3300042604 | Bacteria | 1319 |
| 36 | Ga0466716_090361 | 3300042605 | Bacteria | 12811 |
| 37 | Ga0466720_065230 | 3300042607 | Bacteria | 3992 |
| 38 | Ga0466705_187250 | 3300042612 | Bacteria | 6494 |
| 39 | Ga0466705_333827 | 3300042612 | Bacteria | 9487 |
| 40 | Ga0466731_012393 | 3300042622 | Bacteria | 11846 |
| 41 | Ga0466703_150660 | 3300042636 | Bacteria | 17387 |
| 42 | Ga0466703_193614 | 3300042636 | Bacteria | 8057 |
| 43 | Ga0466704_175805 | 3300042643 | Bacteria | 2906 |
| 44 | Ga0466704_324557 | 3300042643 | Bacteria | 2434 |
| 45 | Ga0466709_376473 | 3300042648 | Bacteria | 1703 |
| 46 | JGI24698J34947_10008872 | 3300002449 | Bacteria | 5519 |
| 47 | Ga0466728_125878 | 3300042620 | Bacteria | 24281 |
| 48 | Ga0466728_128508 | 3300042620 | Bacteria | 10324 |
| 49 | Ga0466728_397204 | 3300042620 | Bacteria | 5593 |
| 50 | Ga0415639_037634 | 3300038395 | Bacteria | 4888 |
| 51 | Ga0466694_012435 | 3300042594 | Bacteria | 9660 |
| 52 | Ga0466695_253971 | 3300042595 | Bacteria | 30792 |
| 53 | Ga0466695_321049 | 3300042595 | Bacteria | 1565 |
| 54 | Ga0466696_259712 | 3300042596 | Bacteria | 29051 |
| 55 | Ga0466707_315228 | 3300042601 | Bacteria | 1416 |
| 56 | Ga0466707_375637 | 3300042601 | Bacteria | 2161 |
| 57 | Ga0466704_333334 | 3300042643 | Bacteria | 2245 |
| 58 | Ga0466704_422311 | 3300042643 | Unclassified | 7391 |
| 59 | Ga0466704_540314 | 3300042643 | Bacteria | 3811 |
| 60 | Ga0466709_349037 | 3300042648 | Bacteria | 3710 |
| 61 | Ga0466708_288804 | 3300042652 | Bacteria | 20693 |
| 62 | Ga0123353_10120015 | 3300010167 | Bacteria | 4228 |
| 63 | Ga0466712_180668 | 3300042614 | Bacteria | 4732 |
| 64 | Ga0466711_062549 | 3300042615 | Bacteria | 3254 |
| 65 | Ga0466711_484605 | 3300042615 | Bacteria | 2418 |
| 66 | Ga0466728_045066 | 3300042620 | Bacteria | 7214 |
| 67 | Ga0466728_227990 | 3300042620 | Bacteria | 2942 |
| 68 | Ga0466699_149738 | 3300042597 | Bacteria | 9645 |
| 69 | Ga0466699_403371 | 3300042597 | Bacteria | 10189 |
| 70 | Ga0466719_010708 | 3300042606 | Bacteria | 4397 |
| 71 | Ga0466722_260200 | 3300042609 | Bacteria | 11199 |
| 72 | Ga0466705_059440 | 3300042612 | Bacteria | 5691 |
| 73 | Ga0466732_358076 | 3300042656 | Bacteria | 7658 |
| 74 | Ga0466703_320231 | 3300042636 | Bacteria | 76119 |
| 75 | Ga0466704_096061 | 3300042643 | Bacteria | 1989 |
| 76 | Ga0466709_055183 | 3300042648 | Bacteria | 6463 |
| 77 | Ga0466709_069892 | 3300042648 | Bacteria | 2119 |
| 78 | Ga0466709_353607 | 3300042648 | Bacteria | 5656 |
| 79 | JGI24698J34947_10014460 | 3300002449 | Bacteria | 4298 |
| 80 | JGI24698J34947_10019462 | 3300002449 | Bacteria | 3661 |
| 81 | JGI24698J34947_10029413 | 3300002449 | Bacteria | 2902 |
| 82 | JGI24695J34938_10000439 | 3300002450 | Bacteria | 40122 |
| 83 | Ga0072941_1003013 | 3300005201 | Bacteria | 3374 |
| 84 | Ga0072941_1009356 | 3300005201 | Bacteria | 21774 |
| 85 | Ga0466711_038798 | 3300042615 | Bacteria | 2136 |
| 86 | Ga0466711_236469 | 3300042615 | Bacteria | 97130 |
| 87 | Ga0466718_169275 | 3300042617 | Bacteria | 2621 |
| 88 | Ga0466726_177957 | 3300042619 | Bacteria | 16745 |
| 89 | Ga0466728_086949 | 3300042620 | Bacteria | 7629 |
| 90 | Ga0264413_119237 | 3300024493 | Bacteria | 6757 |
| 91 | Ga0466691_030135 | 3300042593 | Bacteria | 5145 |
| 92 | Ga0466691_145435 | 3300042593 | Bacteria | 3694 |
| 93 | Ga0466694_129434 | 3300042594 | Bacteria | 2375 |
| 94 | Ga0466696_115940 | 3300042596 | Bacteria | 3308 |
| 95 | Ga0466696_139953 | 3300042596 | Bacteria | 11511 |
| 96 | Ga0466719_517871 | 3300042606 | Bacteria | 2071 |
| 97 | Ga0466720_092544 | 3300042607 | Bacteria | 4222 |
| 98 | Ga0466722_017754 | 3300042609 | Bacteria | 1841 |
| 99 | Ga0466702_151796 | 3300042635 | Bacteria | 28798 |
| 100 | AustNasuHG_c1006050 | 3300000089 | Bacteria | 4322 |
| 101 | JGI24698J34947_10003186 | 3300002449 | Bacteria | 8890 |
| 102 | JGI24698J34947_10012748 | 3300002449 | Bacteria | 4600 |
| 103 | JGI24698J34947_10027076 | 3300002449 | Bacteria | 3043 |
| 104 | JGI24698J34947_10050381 | 3300002449 | Bacteria | 2101 |
| 105 | JGI24698J34947_10067400 | 3300002449 | Bacteria | 1737 |
| 106 | Ga0123356_10020555 | 3300010049 | Bacteria | 6245 |
| 107 | Ga0466705_482804 | 3300042612 | Bacteria | 6735 |
| 108 | Ga0466712_149029 | 3300042614 | Bacteria | 5422 |
| 109 | Ga0466715_226168 | 3300042616 | Bacteria | 12316 |
| 110 | Ga0466715_244472 | 3300042616 | Bacteria | 3467 |
| 111 | Ga0466718_168955 | 3300042617 | Bacteria | 2619 |
| 112 | Ga0466723_202414 | 3300042618 | Bacteria | 6084 |
| 113 | Ga0466691_033582 | 3300042593 | Bacteria | 1685 |
| 114 | Ga0466717_192575 | 3300042604 | Bacteria | 1567 |
| 115 | Ga0466719_063712 | 3300042606 | Bacteria | 26562 |
| 116 | Ga0466722_142566 | 3300042609 | Bacteria | 4316 |
| 117 | Ga0466735_085284 | 3300042624 | Bacteria | 1940 |
| 118 | Ga0466702_392427 | 3300042635 | Bacteria | 3205 |
| 119 | Ga0466703_043532 | 3300042636 | Bacteria | 16956 |
| 120 | Ga0466704_251320 | 3300042643 | Bacteria | 235343 |
| 121 | JGI24698J34947_10023691 | 3300002449 | Bacteria | 3284 |
| 122 | Ga0123353_10007410 | 3300010167 | Bacteria | 14815 |
| 123 | Ga0466705_411325 | 3300042612 | Bacteria | 6453 |
| 124 | Ga0466705_502706 | 3300042612 | Bacteria | 1535 |
| 125 | Ga0466723_150950 | 3300042618 | Bacteria | 119524 |
| 126 | Ga0466728_107104 | 3300042620 | Bacteria | 10380 |
| 127 | Ga0466690_205956 | 3300042590 | Bacteria | 8251 |
| 128 | Ga0466691_010662 | 3300042593 | Bacteria | 3847 |
| 129 | Ga0466694_269553 | 3300042594 | Bacteria | 2785 |
| 130 | Ga0466696_129657 | 3300042596 | Bacteria | 12080 |
| 131 | Ga0466720_083377 | 3300042607 | Bacteria | 2988 |
| 132 | Ga0466705_134074 | 3300042612 | Bacteria | 5593 |
| 133 | Ga0466708_112910 | 3300042652 | Bacteria | 7205 |
| 134 | Ga0466708_264139 | 3300042652 | Bacteria | 1738 |
| 135 | AustNasuHG_c1005269 | 3300000089 | Bacteria | 4619 |
| 136 | AustNasuHG_c1010986 | 3300000089 | Bacteria | 3144 |
| 137 | Ga0466712_028612 | 3300042614 | Bacteria | 1604 |
| 138 | Ga0466712_097212 | 3300042614 | Bacteria | 1488 |
| 139 | Ga0466712_280069 | 3300042614 | Bacteria | 3829 |
| 140 | Ga0466715_260247 | 3300042616 | Bacteria | 3886 |
| 141 | Ga0466715_534972 | 3300042616 | Bacteria | 7927 |
| 142 | Ga0466723_195628 | 3300042618 | Bacteria | 1505 |
| 143 | Ga0466723_351422 | 3300042618 | Bacteria | 7967 |
| 144 | Ga0466692_130857 | 3300042591 | Bacteria | 4190 |
| 145 | Ga0466693_358367 | 3300042592 | Bacteria | 2076 |
| 146 | Ga0466694_333351 | 3300042594 | Bacteria | 5028 |
| 147 | Ga0466696_162868 | 3300042596 | Bacteria | 4789 |
| 148 | Ga0466716_429805 | 3300042605 | Bacteria | 2866 |
| 149 | Ga0466722_202911 | 3300042609 | Bacteria | 11614 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01590 | GO:0005515 | protein binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.