Protein Family IF05021
Metagenome
Isolate
125
Members
36
Samples
123
Scaffolds
254.68
Avg Length
Representative Sequence
- ID
- 3300042594|Ga0466694_231812|Ga0466694_231812_284_1150
- Length
- 288 aa
- Sequence
- VNLILFETHELLKPLPRRDERTVHLLKVLHKKAGDTFEAGVLGGGRCSGKIEKIGIDGSLSFTIGIQSPSPPRLPVRVAVGFPRPIQVRRLLRDLSSLGVEAIDLFGTELGEKSYRDTKLLGGGGARSALIEGAAQSRDTTIPVLSIFTSLENWLQECPWENEGGAVSVPSLHTDTGSHRPPSAPSDRLTSSEWSSGQMELPPRRPAAVPLHIAADNVRPEGAISRMASTKRPVVLAIGSERGWSDRERDMFEEAGFLRLSLGSRALRTETACVAATVLAIEKIGELG
Sample Types
Isolate
1.6%
Metagenome
98.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Kalotermitidae
26.5%
Rhinotermitidae
8.8%
Unclassified
8.8%
Termopsidae
5.9%
Taxonomy
Archaea
0
Bacteria
118
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 19 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 20 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 27 | 2781125656 | Treponema sp. Emb289P1bin65 | Isolate | Unclassified |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 33 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 34 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_008940 | 3300042656 | Bacteria | 1827 |
| 2 | Ga0123356_10316773 | 3300010049 | Bacteria | 1671 |
| 3 | Ga0123354_10305537 | 3300010882 | Bacteria | 1496 |
| 4 | Ga0466694_285787 | 3300042594 | Bacteria | 38692 |
| 5 | Ga0466694_293843 | 3300042594 | Bacteria | 2388 |
| 6 | Ga0466694_320736 | 3300042594 | Bacteria | 9120 |
| 7 | Ga0466699_070973 | 3300042597 | Bacteria | 1481 |
| 8 | Ga0466699_253489 | 3300042597 | Bacteria | 3915 |
| 9 | Ga0466699_419086 | 3300042597 | Bacteria | 1756 |
| 10 | Ga0466699_432121 | 3300042597 | Bacteria | 1180 |
| 11 | Ga0466707_096479 | 3300042601 | Bacteria | 2299 |
| 12 | Ga0466717_265347 | 3300042604 | Bacteria | 4146 |
| 13 | JGI24698J34947_10000516 | 3300002449 | Bacteria | 18226 |
| 14 | JGI24698J34947_10013200 | 3300002449 | Bacteria | 4514 |
| 15 | JGI24698J34947_10025949 | 3300002449 | Bacteria | 3116 |
| 16 | JGI24698J34947_10053923 | 3300002449 | Bacteria | 2010 |
| 17 | JGI24698J34947_10080589 | 3300002449 | Unclassified | 1529 |
| 18 | JGI24695J34938_10000290 | 3300002450 | Unclassified | 49669 |
| 19 | JGI24695J34938_10007739 | 3300002450 | Bacteria | 6228 |
| 20 | Ga0072940_1001818 | 3300005200 | Bacteria | 7055 |
| 21 | Ga0466712_073534 | 3300042614 | Bacteria | 6292 |
| 22 | Ga0466712_202943 | 3300042614 | Bacteria | 2112 |
| 23 | Ga0466712_204006 | 3300042614 | Bacteria | 2739 |
| 24 | Ga0466715_309971 | 3300042616 | Bacteria | 7071 |
| 25 | Ga0466729_088903 | 3300042621 | Bacteria | 8390 |
| 26 | Ga0123356_10104142 | 3300010049 | Bacteria | 2727 |
| 27 | Ga0123353_10497279 | 3300010167 | Bacteria | 1778 |
| 28 | Ga0123353_11268503 | 3300010167 | Bacteria | 960 |
| 29 | Ga0123354_10136717 | 3300010882 | Unclassified | 3059 |
| 30 | Ga0466692_200957 | 3300042591 | Bacteria | 2755 |
| 31 | Ga0466694_069940 | 3300042594 | Bacteria | 18221 |
| 32 | Ga0466694_140737 | 3300042594 | Bacteria | 2037 |
| 33 | Ga0466694_231812 | 3300042594 | Bacteria | 1374 |
| 34 | Ga0466720_032894 | 3300042607 | Bacteria | 15096 |
| 35 | Ga0466720_098651 | 3300042607 | Bacteria | 30361 |
| 36 | Ga0466720_125042 | 3300042607 | Bacteria | 1451 |
| 37 | Ga0466720_170729 | 3300042607 | Bacteria | 6409 |
| 38 | JGI24698J34947_10011535 | 3300002449 | Bacteria | 4852 |
| 39 | Ga0466712_048231 | 3300042614 | Bacteria | 21473 |
| 40 | Ga0466712_167842 | 3300042614 | Bacteria | 4216 |
| 41 | Ga0466711_340701 | 3300042615 | Bacteria | 2590 |
| 42 | Ga0466726_243117 | 3300042619 | Bacteria | 14736 |
| 43 | Ga0466702_378082 | 3300042635 | Bacteria | 3912 |
| 44 | Ga0466705_018878 | 3300042612 | Bacteria | 2038 |
| 45 | Ga0123356_10088853 | 3300010049 | Bacteria | 2939 |
| 46 | Ga0123353_11103015 | 3300010167 | Bacteria | 1053 |
| 47 | Ga0466692_176759 | 3300042591 | Bacteria | 3071 |
| 48 | Ga0466699_324577 | 3300042597 | Bacteria | 4740 |
| 49 | Ga0466707_174292 | 3300042601 | Bacteria | 1472 |
| 50 | Ga0466720_042491 | 3300042607 | Bacteria | 7915 |
| 51 | Ga0466720_075638 | 3300042607 | Bacteria | 2658 |
| 52 | Ga0466720_232819 | 3300042607 | Bacteria | 1732 |
| 53 | JGI24698J34947_10008388 | 3300002449 | Bacteria | 5671 |
| 54 | Ga0072940_1022666 | 3300005200 | Bacteria | 5242 |
| 55 | Ga0466705_082328 | 3300042612 | Bacteria | 3829 |
| 56 | Ga0264413_119857 | 3300024493 | Bacteria | 7085 |
| 57 | Ga0466692_062847 | 3300042591 | Bacteria | 4421 |
| 58 | Ga0466694_027240 | 3300042594 | Bacteria | 14900 |
| 59 | Ga0466694_165381 | 3300042594 | Bacteria | 1395 |
| 60 | Ga0466694_409225 | 3300042594 | Bacteria | 36264 |
| 61 | Ga0466716_271802 | 3300042605 | Bacteria | 8204 |
| 62 | Ga0466720_178854 | 3300042607 | Unclassified | 5619 |
| 63 | Ga0466720_192734 | 3300042607 | Bacteria | 2660 |
| 64 | JGI24698J34947_10009564 | 3300002449 | Bacteria | 5319 |
| 65 | JGI24695J34938_10045736 | 3300002450 | Bacteria | 1940 |
| 66 | Ga0072941_1004316 | 3300005201 | Bacteria | 33459 |
| 67 | Ga0072941_1012642 | 3300005201 | Bacteria | 9566 |
| 68 | Ga0466712_058450 | 3300042614 | Bacteria | 7817 |
| 69 | Ga0466712_274014 | 3300042614 | Bacteria | 1216 |
| 70 | Ga0466726_146371 | 3300042619 | Bacteria | 1240 |
| 71 | Ga0466704_414876 | 3300042643 | Bacteria | 5328 |
| 72 | Ga0466732_427349 | 3300042656 | Bacteria | 2817 |
| 73 | Ga0123353_10106398 | 3300010167 | Bacteria | 4520 |
| 74 | Ga0415639_181075 | 3300038395 | Bacteria | 2875 |
| 75 | Ga0466699_029835 | 3300042597 | Bacteria | 13973 |
| 76 | Ga0466720_074271 | 3300042607 | Bacteria | 9576 |
| 77 | Ga0466720_165120 | 3300042607 | Bacteria | 1350 |
| 78 | JGI24698J34947_10003957 | 3300002449 | Bacteria | 8058 |
| 79 | JGI24698J34947_10004403 | 3300002449 | Bacteria | 7666 |
| 80 | Ga0072941_1077465 | 3300005201 | Bacteria | 2787 |
| 81 | Ga0072941_1137461 | 3300005201 | Bacteria | 4667 |
| 82 | Ga0466712_189763 | 3300042614 | Bacteria | 10684 |
| 83 | Ga0466718_152256 | 3300042617 | Bacteria | 1504 |
| 84 | Ga0123356_10069036 | 3300010049 | Bacteria | 3313 |
| 85 | Ga0466690_118429 | 3300042590 | Bacteria | 1518 |
| 86 | Ga0466692_101102 | 3300042591 | Bacteria | 6344 |
| 87 | Ga0466692_182973 | 3300042591 | Bacteria | 1818 |
| 88 | Ga0466700_439687 | 3300042600 | Bacteria | 1127 |
| 89 | Ga0466720_092177 | 3300042607 | Bacteria | 42147 |
| 90 | Ga0466720_125366 | 3300042607 | Bacteria | 14214 |
| 91 | Ga0466722_012945 | 3300042609 | Bacteria | 10242 |
| 92 | Ga0466722_185308 | 3300042609 | Bacteria | 17287 |
| 93 | Ga0466722_264027 | 3300042609 | Bacteria | 1484 |
| 94 | Ga0466698_466528 | 3300042610 | Bacteria | 9053 |
| 95 | JGI24698J34947_10053985 | 3300002449 | Bacteria | 2009 |
| 96 | Ga0466712_032180 | 3300042614 | Bacteria | 7476 |
| 97 | Ga0466712_125211 | 3300042614 | Bacteria | 1568 |
| 98 | Ga0466712_136961 | 3300042614 | Bacteria | 7783 |
| 99 | Ga0466712_264634 | 3300042614 | Bacteria | 1299 |
| 100 | Ga0466718_037199 | 3300042617 | Bacteria | 3163 |
| 101 | Ga0415639_014332 | 3300038395 | Bacteria | 6133 |
| 102 | Ga0466691_175704 | 3300042593 | Bacteria | 16463 |
| 103 | Ga0466699_000894 | 3300042597 | Bacteria | 31514 |
| 104 | Ga0466720_082800 | 3300042607 | Unclassified | 1239 |
| 105 | Ga0072941_1002176 | 3300005201 | Bacteria | 7975 |
| 106 | Ga0466712_009196 | 3300042614 | Bacteria | 1375 |
| 107 | Ga0466712_261940 | 3300042614 | Bacteria | 11096 |
| 108 | Ga0466702_285481 | 3300042635 | Bacteria | 1742 |
| 109 | Ga0466709_198778 | 3300042648 | Bacteria | 15427 |
| 110 | Ga0123353_10185084 | 3300010167 | Unclassified | 3294 |
| 111 | Ga0264413_114137 | 3300024493 | Bacteria | 16322 |
| 112 | Ga0466692_081675 | 3300042591 | Bacteria | 1999 |
| 113 | Ga0466720_031298 | 3300042607 | Bacteria | 12428 |
| 114 | Ga0466720_157358 | 3300042607 | Bacteria | 5370 |
| 115 | Ga0466720_218533 | 3300042607 | Bacteria | 7675 |
| 116 | Ga0466720_228424 | 3300042607 | Bacteria | 12236 |
| 117 | Ga0072941_1013284 | 3300005201 | Bacteria | 4595 |
| 118 | Ga0466712_038950 | 3300042614 | Bacteria | 1714 |
| 119 | Ga0466711_066856 | 3300042615 | Bacteria | 1712 |
| 120 | Ga0466702_409959 | 3300042635 | Bacteria | 1302 |
| 121 | Ga0466703_341938 | 3300042636 | Unclassified | 7047 |
| 122 | Ga0466727_102424 | 3300042655 | Bacteria | 6018 |
| 123 | Ga0466727_167989 | 3300042655 | Bacteria | 2948 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04452 | Methyltrans_RNA | RNA methyltransferase domain | 73 | 158 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.