Protein Family IF04982

Metagenome Isolate
134 Members
36 Samples
121 Scaffolds
115.25 Avg Length

🧬 Representative Sequence

ID
3300042594|Ga0466694_080470|Ga0466694_080470_1950_2351
Length
133 aa
Sequence
MTERRKGLFNCGKESYNVSMSNCLFCKIIAEEIPAKKLYEDDEMLAFYDINPMAPVHFLIIPKKHIENLFLLEASDAALAGRLFHKAQELAKEQGYEEKGGRFVINAKTDGGQTVDHLHIHFLGGRALGWPPG

📊 Sample Types

Isolate 9.7%
Metagenome 90.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 54.5%
Unclassified 39.4%
Kalotermitidae 3.0%
Termopsidae 3.0%

🌳 Taxonomy

Archaea 1
Bacteria 121
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
2 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
6 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
7 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
8 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
9 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
10 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
11 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
12 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
13 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
14 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
15 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
16 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
17 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
18 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
19 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
20 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
21 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
22 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
23 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
24 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
25 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
26 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
27 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
28 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
29 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
30 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
31 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
32 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
33 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
34 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
35 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified
36 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466731_399803 3300042622 Unclassified 2287
2 Ga0466702_053020 3300042635 Bacteria 8380
3 Ga0466693_173988 3300042592 Bacteria 3514
4 Ga0466693_437262 3300042592 Bacteria 1376
5 Ga0466712_005884 3300042614 Bacteria 7995
6 FAAS_10623073 3300001880 Unclassified 503
7 JGI24698J34947_10027257 3300002449 Bacteria 3033
8 JGI24698J34947_10325889 3300002449 Bacteria 545
9 JGI24695J34938_10001117 3300002450 Bacteria 24194
10 JGI24695J34938_10028321 3300002450 Bacteria 2634
11 Ga0072940_1008404 3300005200 Bacteria 8231
12 Ga0072941_1023480 3300005201 Bacteria 2388
13 Ga0072941_1115285 3300005201 Bacteria 2876
14 Ga0123356_10002169 3300010049 Bacteria 21123
15 Ga0123356_10014621 3300010049 Bacteria 7543
16 Ga0123356_10029672 3300010049 Bacteria 5120
17 Ga0466694_251341 3300042594 Bacteria 19435
18 Ga0466699_176973 3300042597 Bacteria 4872
19 Ga0466723_160295 3300042618 Bacteria 2766
20 JGI24698J34947_10077168 3300002449 Bacteria 1576
21 JGI24695J34938_10000609 3300002450 Bacteria 34314
22 JGI24695J34938_10001935 3300002450 Bacteria 16679
23 JGI24695J34938_10008129 3300002450 Bacteria 6037
24 JGI24695J34938_10009493 3300002450 Bacteria 5407
25 JGI24695J34938_10173250 3300002450 Bacteria 891
26 Ga0123356_10106604 3300010049 Bacteria 2698
27 Ga0123356_10603589 3300010049 Bacteria 1262
28 Ga0123353_10094421 3300010167 Bacteria 4819
29 Ga0466731_426188 3300042622 Bacteria 3952
30 Ga0415639_001523 3300038395 Unclassified 9342
31 Ga0466694_092846 3300042594 Bacteria 2566
32 Ga0466694_107250 3300042594 Bacteria 5173
33 Ga0466694_212689 3300042594 Bacteria 44215
34 Ga0466699_055961 3300042597 Bacteria 5475
35 JGI24698J34947_10039367 3300002449 Bacteria 2448
36 JGI24695J34938_10000406 3300002450 Bacteria 41980
37 JGI24695J34938_10001073 3300002450 Bacteria 24681
38 JGI24695J34938_10071027 3300002450 Bacteria 1455
39 Ga0072941_1013569 3300005201 Bacteria 19449
40 Ga0072941_1052653 3300005201 Bacteria 4702
41 Ga0123356_10001885 3300010049 Bacteria 22734
42 Ga0466700_124474 3300042600 Bacteria 21452
43 Ga0466702_381433 3300042635 Bacteria 1247
44 Ga0264413_102823 3300024493 Bacteria 6402
45 Ga0466699_076612 3300042597 Bacteria 1162
46 Ga0466699_110188 3300042597 Bacteria 9182
47 Ga0466712_031622 3300042614 Bacteria 3372
48 Ga0466718_036877 3300042617 Bacteria 6893
49 AustNasuHG_c1001488 3300000089 Bacteria 8392
50 AustNasuHG_c1002329 3300000089 Bacteria 6863
51 JGI24695J34938_10002196 3300002450 Bacteria 15223
52 JGI24695J34938_10010074 3300002450 Unclassified 5208
53 JGI24695J34938_10012469 3300002450 Bacteria 4502
54 JGI24695J34938_10073770 3300002450 Bacteria 1421
55 Ga0123356_10001799 3300010049 Bacteria 23355
56 Ga0123356_10039586 3300010049 Bacteria 4392
57 Ga0123356_10099488 3300010049 Bacteria 2787
58 Ga0466698_121989 3300042610 Bacteria 11045
59 Ga0264413_132593 3300024493 Bacteria 1277
60 Ga0466699_304965 3300042597 Bacteria 1249
61 Ga0466699_356432 3300042597 Bacteria 5268
62 Ga0466699_370126 3300042597 Bacteria 1138
63 Ga0466712_001541 3300042614 Bacteria 16481
64 Ga0466712_011061 3300042614 Bacteria 35143
65 Ga0466718_026330 3300042617 Bacteria 1016
66 Ga0466718_038102 3300042617 Bacteria 5796
67 AustNasuHG_c1035795 3300000089 Unclassified 1301
68 JGI24698J34947_10013507 3300002449 Bacteria 4456
69 JGI24698J34947_10045390 3300002449 Bacteria 2243
70 JGI24695J34938_10000944 3300002450 Bacteria 26485
71 JGI24695J34938_10357446 3300002450 Bacteria 643
72 Ga0072940_1009052 3300005200 Bacteria 1793
73 Ga0072941_1060901 3300005201 Bacteria 4371
74 Ga0123356_10001636 3300010049 Unclassified 24590
75 Ga0123356_11764547 3300010049 Archaea 769
76 Ga0466720_200560 3300042607 Unclassified 1660
77 Ga0466731_161634 3300042622 Bacteria 1608
78 Ga0466702_006102 3300042635 Bacteria 2485
79 Ga0466702_342433 3300042635 Bacteria 1773
80 Ga0466694_134377 3300042594 Bacteria 7803
81 Ga0466694_346911 3300042594 Bacteria 10059
82 Ga0466699_346254 3300042597 Bacteria 1298
83 Ga0466712_035207 3300042614 Bacteria 27664
84 Ga0466718_080262 3300042617 Bacteria 12317
85 JGI24698J34947_10041127 3300002449 Bacteria 2382
86 JGI24698J34947_10100487 3300002449 Bacteria 1302
87 JGI24695J34938_10005703 3300002450 Bacteria 7686
88 JGI24695J34938_10142406 3300002450 Unclassified 980
89 JGI24695J34938_10342246 3300002450 Unclassified 655
90 Ga0072941_1021001 3300005201 Bacteria 8666
91 Ga0072941_1052652 3300005201 Bacteria 3823
92 Ga0123356_10001661 3300010049 Bacteria 24345
93 Ga0466717_238682 3300042604 Bacteria 1405
94 Ga0466694_306817 3300042594 Bacteria 5363
95 Ga0466726_446182 3300042619 Bacteria 5505
96 AustNasuHG_c1058651 3300000089 Bacteria 759
97 JGI24695J34938_10007341 3300002450 Bacteria 6475
98 JGI24695J34938_10015597 3300002450 Bacteria 3893
99 JGI24695J34938_10125111 3300002450 Bacteria 1047
100 Ga0072941_1008242 3300005201 Bacteria 4218
101 Ga0072941_1036138 3300005201 Bacteria 19346
102 Ga0123356_10002761 3300010049 Bacteria 18643
103 Ga0466720_223781 3300042607 Bacteria 2666
104 Ga0466731_126282 3300042622 Bacteria 2918
105 Ga0466702_085819 3300042635 Bacteria 1779
106 Ga0466702_460894 3300042635 Bacteria 11946
107 Ga0264413_107359 3300024493 Bacteria 6434
108 Ga0264413_107914 3300024493 Bacteria 9579
109 Ga0466694_080470 3300042594 Bacteria 4852
110 Ga0466712_030029 3300042614 Bacteria 7731
111 Ga0466712_040293 3300042614 Unclassified 1590
112 Ga0466712_163690 3300042614 Bacteria 10462
113 Ga0466712_217436 3300042614 Bacteria 1171
114 JGI24698J34947_10013173 3300002449 Unclassified 4519
115 JGI24698J34947_10329410 3300002449 Unclassified 541
116 JGI24695J34938_10000008 3300002450 Bacteria 136681
117 JGI24695J34938_10001543 3300002450 Bacteria 19410
118 JGI24695J34938_10035663 3300002450 Bacteria 2273
119 Ga0072941_1052651 3300005201 Bacteria 2183
120 Ga0072941_1216895 3300005201 Bacteria 956
121 Ga0123356_10006728 3300010049 Bacteria 11584

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042619 Ga0466726_446182 Ga0466726_446182_146_481 111
2 3300002450 JGI24695J34938_10342246 JGI24695J34938_103422461 113
3 iso_pr_bacteria 2781125638 2781284751 113
4 3300002449 JGI24698J34947_10013507 JGI24698J34947_100135076 114
5 3300002450 JGI24695J34938_10000008 JGI24695J34938_1000000888 114
6 3300002450 JGI24695J34938_10001073 JGI24695J34938_1000107323 114
7 3300002450 JGI24695J34938_10009493 JGI24695J34938_100094936 114
8 3300024493 Ga0264413_102823 Ga0264413_1028238 114
9 3300024493 Ga0264413_107914 Ga0264413_1079145 114
10 3300024493 Ga0264413_132593 Ga0264413_1325932 114
11 3300038395 Ga0415639_001523 Ga0415639_001523_4583_4927 114
12 3300042592 Ga0466693_173988 Ga0466693_173988_2918_3262 114
13 3300042592 Ga0466693_437262 Ga0466693_437262_792_1136 114
14 3300042594 Ga0466694_107250 Ga0466694_107250_2141_2485 114
15 3300042594 Ga0466694_134377 Ga0466694_134377_3292_3636 114
16 3300042594 Ga0466694_212689 Ga0466694_212689_20918_21262 114
17 3300042594 Ga0466694_251341 Ga0466694_251341_11712_12056 114
18 3300042594 Ga0466694_346911 Ga0466694_346911_7852_8196 114
19 3300042597 Ga0466699_055961 Ga0466699_055961_972_1316 114
20 3300042597 Ga0466699_076612 Ga0466699_076612_807_1151 114
21 3300042597 Ga0466699_110188 Ga0466699_110188_1368_1712 114
22 3300042597 Ga0466699_176973 Ga0466699_176973_1801_2145 114
23 3300042597 Ga0466699_304965 Ga0466699_304965_617_961 114
24 3300042597 Ga0466699_346254 Ga0466699_346254_13_357 114
25 3300042597 Ga0466699_356432 Ga0466699_356432_798_1142 114
26 3300042597 Ga0466699_370126 Ga0466699_370126_704_1066 114
27 3300042600 Ga0466700_124474 Ga0466700_124474_5105_5449 114
28 3300042604 Ga0466717_238682 Ga0466717_238682_564_908 114
29 3300042607 Ga0466720_223781 Ga0466720_223781_1570_1914 114
30 3300042614 Ga0466712_001541 Ga0466712_001541_9037_9381 114
31 3300042614 Ga0466712_005884 Ga0466712_005884_6245_6589 114
32 3300042614 Ga0466712_011061 Ga0466712_011061_4592_4936 114
33 3300042614 Ga0466712_030029 Ga0466712_030029_1358_1702 114
34 3300042614 Ga0466712_031622 Ga0466712_031622_1422_1766 114
35 3300042614 Ga0466712_035207 Ga0466712_035207_13444_13788 114
36 3300042614 Ga0466712_040293 Ga0466712_040293_127_471 114
37 3300042614 Ga0466712_163690 Ga0466712_163690_3962_4306 114
38 3300042614 Ga0466712_217436 Ga0466712_217436_641_985 114
39 3300042617 Ga0466718_026330 Ga0466718_026330_431_775 114
40 3300042617 Ga0466718_036877 Ga0466718_036877_4019_4363 114
41 3300042617 Ga0466718_038102 Ga0466718_038102_1402_1746 114
42 3300042617 Ga0466718_080262 Ga0466718_080262_2225_2569 114
43 3300042618 Ga0466723_160295 Ga0466723_160295_1900_2244 114
44 3300042622 Ga0466731_126282 Ga0466731_126282_1924_2268 114
45 3300042622 Ga0466731_161634 Ga0466731_161634_503_847 114
46 3300042622 Ga0466731_399803 Ga0466731_399803_1470_1814 114
47 3300042622 Ga0466731_426188 Ga0466731_426188_145_489 114
48 3300042635 Ga0466702_006102 Ga0466702_006102_392_736 114
49 3300042635 Ga0466702_053020 Ga0466702_053020_2524_2868 114
50 3300042635 Ga0466702_085819 Ga0466702_085819_938_1282 114
51 3300042635 Ga0466702_342433 Ga0466702_342433_1288_1632 114
52 3300042635 Ga0466702_381433 Ga0466702_381433_773_1117 114
53 3300042635 Ga0466702_460894 Ga0466702_460894_149_493 114
54 iso_pr_bacteria 2781125634 2781273688 114
55 iso_pr_bacteria 2781125636 2781280402 114
56 iso_pr_bacteria 2781125642 2781292528 114
57 iso_pr_bacteria 2781125643 2781294044 114
58 iso_pr_bacteria 2781125646 2781301609 114
59 iso_pr_bacteria 2781125648 2781305446 114
60 iso_pr_bacteria 2781125659 2781327225 114
61 iso_pr_bacteria 2781125662 2781337152 114
62 iso_pr_bacteria 2781125663 2781337693 114
63 3300000089 AustNasuHG_c1002329 AustNasuHG_10023296 115
64 3300000089 AustNasuHG_c1035795 AustNasuHG_10357952 115
65 3300000089 AustNasuHG_c1058651 AustNasuHG_10586512 115
66 3300002449 JGI24698J34947_10013173 JGI24698J34947_100131733 115
67 3300002449 JGI24698J34947_10027257 JGI24698J34947_100272573 115
68 3300002449 JGI24698J34947_10039367 JGI24698J34947_100393673 115
69 3300002449 JGI24698J34947_10041127 JGI24698J34947_100411273 115
70 3300002449 JGI24698J34947_10045390 JGI24698J34947_100453903 115
71 3300002449 JGI24698J34947_10077168 JGI24698J34947_100771682 115
72 3300002449 JGI24698J34947_10100487 JGI24698J34947_101004873 115
73 3300002449 JGI24698J34947_10325889 JGI24698J34947_103258891 115
74 3300002449 JGI24698J34947_10329410 JGI24698J34947_103294101 115
75 3300002450 JGI24695J34938_10000406 JGI24695J34938_1000040624 115
76 3300002450 JGI24695J34938_10000609 JGI24695J34938_1000060927 115
77 3300002450 JGI24695J34938_10000944 JGI24695J34938_1000094423 115
78 3300002450 JGI24695J34938_10001117 JGI24695J34938_100011176 115
79 3300002450 JGI24695J34938_10001543 JGI24695J34938_1000154313 115
80 3300002450 JGI24695J34938_10001935 JGI24695J34938_100019355 115
81 3300002450 JGI24695J34938_10002196 JGI24695J34938_100021969 115
82 3300002450 JGI24695J34938_10007341 JGI24695J34938_100073412 115
83 3300002450 JGI24695J34938_10008129 JGI24695J34938_100081297 115
84 3300002450 JGI24695J34938_10010074 JGI24695J34938_100100747 115
85 3300002450 JGI24695J34938_10012469 JGI24695J34938_100124699 115
86 3300002450 JGI24695J34938_10015597 JGI24695J34938_100155976 115
87 3300002450 JGI24695J34938_10028321 JGI24695J34938_100283213 115
88 3300002450 JGI24695J34938_10035663 JGI24695J34938_100356633 115
89 3300002450 JGI24695J34938_10071027 JGI24695J34938_100710272 115
90 3300002450 JGI24695J34938_10073770 JGI24695J34938_100737702 115
91 3300002450 JGI24695J34938_10125111 JGI24695J34938_101251112 115
92 3300002450 JGI24695J34938_10142406 JGI24695J34938_101424062 115
93 3300002450 JGI24695J34938_10173250 JGI24695J34938_101732502 115
94 3300005201 Ga0072941_1008242 Ga0072941_10082425 115
95 3300005201 Ga0072941_1013569 Ga0072941_101356914 115
96 3300005201 Ga0072941_1021001 Ga0072941_10210018 115
97 3300005201 Ga0072941_1023480 Ga0072941_10234804 115
98 3300005201 Ga0072941_1036138 Ga0072941_10361387 115
99 3300005201 Ga0072941_1060901 Ga0072941_10609013 115
100 3300005201 Ga0072941_1115285 Ga0072941_11152851 115
101 3300005201 Ga0072941_1216895 Ga0072941_12168952 115
102 3300010049 Ga0123356_10001636 Ga0123356_1000163614 115
103 3300010049 Ga0123356_10001661 Ga0123356_100016617 115
104 3300010049 Ga0123356_10001799 Ga0123356_1000179917 115
105 3300010049 Ga0123356_10001885 Ga0123356_100018855 115
106 3300010049 Ga0123356_10002169 Ga0123356_1000216913 115
107 3300010049 Ga0123356_10014621 Ga0123356_100146217 115
108 3300010049 Ga0123356_10029672 Ga0123356_100296724 115
109 3300010049 Ga0123356_10099488 Ga0123356_100994884 115
110 3300010049 Ga0123356_10106604 Ga0123356_101066045 115
111 3300010049 Ga0123356_10603589 Ga0123356_106035892 115
112 3300010049 Ga0123356_11764547 Ga0123356_117645472 115
113 3300010167 Ga0123353_10094421 Ga0123353_100944214 115
114 iso_pr_bacteria 2781125635 2781279027 116
115 iso_pr_bacteria 2781125645 2781299993 116
116 3300002450 JGI24695J34938_10005703 JGI24695J34938_100057035 117
117 3300000089 AustNasuHG_c1001488 AustNasuHG_10014885 118
118 3300024493 Ga0264413_107359 Ga0264413_1073594 118
119 3300042607 Ga0466720_200560 Ga0466720_200560_1067_1423 118
120 3300005201 Ga0072941_1052651 Ga0072941_10526513 119
121 3300005201 Ga0072941_1052652 Ga0072941_10526523 119
122 3300005201 Ga0072941_1052653 Ga0072941_10526538 119
123 3300042594 Ga0466694_092846 Ga0466694_092846_2073_2432 119
124 3300042610 Ga0466698_121989 Ga0466698_121989_2663_3022 119
125 iso_pr_bacteria 2781125661 2781333887 119
126 3300001880 FAAS_10623073 FAAS_106230731 120
127 3300002450 JGI24695J34938_10357446 JGI24695J34938_103574461 120
128 3300005200 Ga0072940_1008404 Ga0072940_10084046 120
129 3300005200 Ga0072940_1009052 Ga0072940_10090523 120
130 3300010049 Ga0123356_10002761 Ga0123356_100027614 120
131 3300010049 Ga0123356_10006728 Ga0123356_100067283 120
132 3300010049 Ga0123356_10039586 Ga0123356_100395862 120
133 3300042594 Ga0466694_306817 Ga0466694_306817_1454_1834 126
134 3300042594 Ga0466694_080470 Ga0466694_080470_1950_2351 133

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01230 HIT HIT domain 31 127 0.96
PF11969 DcpS_C Scavenger mRNA decapping enzyme C-term binding 22 124 0.9

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01230 GO:0003824 catalytic activity MF

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.76 0.84 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.