Protein Family IF04957
Metagenome
Isolate
258
Members
70
Samples
234
Scaffolds
341.71
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_223761|Ga0466691_223761_41_1279
- Length
- 412 aa
- Sequence
- LIFGNKFRTKNYTKNSKNSLQIFFSRLLLQLILKTFSVFWYGGLRTLKNAAGITDKSRRIEMKSPGKGGIFMEQLKIGVIGTGRIGKIHAENIARFIPQARLEGIADIKLTAEQEAWAKALGARIVSKDPEDLLKDSSIEAVIICSSTDTHADLTAAAAGAGKQIFCEKPVDLSVPKVKEALDAVKQAGVKLQIGFNRRFDHNFARIRRYTLDGEIGQVQIVKITSRDPAPPPPAYVAVSGGIFLDMMIHDFDMARFQAGSGITEVFAAGAVLVDPEIGKAGDVDTALVTLRFANGAIGVIDNSRKAVYGYDQRVEVFGSKGSAAAENDLPNTVRLSNEKCVSGEKPLYFFLERYKQAFVDEMVSFVDAVQNDKPTAVSGEDGLEDMYAALAAGKSLKEKRPVAVEEIRSAY
Sample Types
Isolate
9.3%
Metagenome
90.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
24.3%
Unclassified
22.9%
Kalotermitidae
21.4%
Tenebrionidae
7.1%
Rhinotermitidae
4.3%
Apidae
4.3%
Termopsidae
4.3%
Curculionidae
2.9%
Armadillidiidae
1.4%
Stratiomyidae
1.4%
Hydrophilidae
1.4%
Blaberidae
1.4%
Formicidae
1.4%
Blattidae
1.4%
Taxonomy
Archaea
0
Bacteria
255
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 2 | 2808606958 | Lactobacillus sp. ESL0449 v2 | Isolate | Unclassified |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 6 | 3300012829 | Enriched pill bug-associated microbial communities from UW Madison campus, WI, USA - HID1972I_E11 MG | Metagenome | Armadillidiidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 9 | 3300056564 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PS_oats (Improved Draft) | Metagenome | Tenebrionidae |
| 10 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 11 | 8030337018 | Tissierella sp. Yu-01 | Isolate | Stratiomyidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 14 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 3300000333 | Honey bee gut microbial communities from New Haven, Connecticut, USA - Honey Bee colony | Metagenome | Apidae |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 2870910722 | Gilliamella apicola wkB112 | Isolate | Apidae |
| 25 | 2873581347 | Vagococcus hydrophili HDW17B | Isolate | Hydrophilidae |
| 26 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 27 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 28 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 29 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 32 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 33 | 2758568561 | Bombilactobacillus mellis ESL0292 | Isolate | Unclassified |
| 34 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 35 | 2820424542 | Unclassified Firmicutes Lab288P3bin47 | Isolate | Unclassified |
| 36 | 3300007083 | Ant gut microbial communities from Cephalotes persimilis, Brazil | Metagenome | Formicidae |
| 37 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 38 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 39 | 8012939035 | Enterococcus sp. UD-01 | Isolate | Tenebrionidae |
| 40 | 2820420508 | Unclassified Firmicutes Lab288P3bin68 | Isolate | Unclassified |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 42 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 43 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 44 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 45 | 2636416028 | Pelosinus propionicus DSM 13327 | Isolate | Unclassified |
| 46 | 2820223845 | Unclassified Firmicutes Th196P4bin57 | Isolate | Unclassified |
| 47 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 48 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 50 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 51 | 2576861701 | Paenibacillus sp. JCM 10914 | Isolate | Termitidae |
| 52 | 2758568557 | Bombilactobacillus mellis ESL0394 | Isolate | Unclassified |
| 53 | 2758568559 | Bombilactobacillus mellis ESL0295 | Isolate | Unclassified |
| 54 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 55 | 2956926959 | Bombilactobacillus bombi BI-1.1 | Isolate | Apidae |
| 56 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 57 | 8103002986 | Erwinia sp. S38 | Isolate | Curculionidae |
| 58 | 8103008710 | Erwinia sp. S43 | Isolate | Curculionidae |
| 59 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 60 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 61 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 62 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 63 | 2758568560 | Bombilactobacillus mellis ESL0294 | Isolate | Unclassified |
| 64 | 2820418027 | Unclassified Firmicutes Lab288P3bin85 | Isolate | Unclassified |
| 65 | 2630968413 | Bombilactobacillus mellifer Bin4 | Isolate | Unclassified |
| 66 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 67 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 68 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 69 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 70 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_147280 | 3300042612 | Bacteria | 1924 |
| 2 | Ga0530661_001875 | 3300056564 | Unclassified | 9248 |
| 3 | Ga0466711_111716 | 3300042615 | Bacteria | 24512 |
| 4 | Ga0466711_267702 | 3300042615 | Bacteria | 2142 |
| 5 | Ga0466711_307317 | 3300042615 | Bacteria | 4266 |
| 6 | Ga0466715_181055 | 3300042616 | Bacteria | 14551 |
| 7 | Ga0466715_376657 | 3300042616 | Bacteria | 2098 |
| 8 | Ga0466715_381540 | 3300042616 | Bacteria | 8208 |
| 9 | Ga0466723_094175 | 3300042618 | Bacteria | 26461 |
| 10 | Ga0466726_034143 | 3300042619 | Bacteria | 45757 |
| 11 | Ga0466707_393556 | 3300042601 | Bacteria | 121495 |
| 12 | AustNasuHG_c1025657 | 3300000089 | Bacteria | 1847 |
| 13 | JGI24696J40584_12945207 | 3300002834 | Bacteria | 1842 |
| 14 | Ga0466690_001162 | 3300042590 | Bacteria | 11357 |
| 15 | Ga0466690_181360 | 3300042590 | Bacteria | 5875 |
| 16 | Ga0466691_040466 | 3300042593 | Bacteria | 8214 |
| 17 | Ga0466691_098205 | 3300042593 | Bacteria | 2376 |
| 18 | Ga0466696_016014 | 3300042596 | Bacteria | 6118 |
| 19 | Ga0466699_203030 | 3300042597 | Bacteria | 1458 |
| 20 | Ga0466729_262976 | 3300042621 | Bacteria | 3135 |
| 21 | Ga0466703_022176 | 3300042636 | Bacteria | 4341 |
| 22 | Ga0466703_130402 | 3300042636 | Bacteria | 8224 |
| 23 | Ga0466703_258371 | 3300042636 | Bacteria | 7853 |
| 24 | Ga0466703_315281 | 3300042636 | Bacteria | 1904 |
| 25 | Ga0466709_305197 | 3300042648 | Bacteria | 10392 |
| 26 | Ga0466709_386244 | 3300042648 | Bacteria | 35005 |
| 27 | Ga0466709_390918 | 3300042648 | Bacteria | 1350 |
| 28 | Ga0466708_040420 | 3300042652 | Bacteria | 20597 |
| 29 | Ga0466708_126812 | 3300042652 | Bacteria | 3761 |
| 30 | Ga0466727_007877 | 3300042655 | Bacteria | 11071 |
| 31 | Ga0466727_216576 | 3300042655 | Bacteria | 9597 |
| 32 | Ga0466705_062309 | 3300042612 | Bacteria | 6400 |
| 33 | Ga0466705_339347 | 3300042612 | Bacteria | 2305 |
| 34 | Ga0466711_275454 | 3300042615 | Bacteria | 22441 |
| 35 | Ga0466715_025238 | 3300042616 | Bacteria | 5198 |
| 36 | Ga0466715_459307 | 3300042616 | Bacteria | 20292 |
| 37 | Ga0466715_637882 | 3300042616 | Bacteria | 40389 |
| 38 | Ga0466726_017510 | 3300042619 | Bacteria | 1464 |
| 39 | Ga0466726_159582 | 3300042619 | Bacteria | 14093 |
| 40 | Ga0123353_10000995 | 3300010167 | Bacteria | 34746 |
| 41 | Ga0123353_10006141 | 3300010167 | Bacteria | 15951 |
| 42 | Ga0123353_10208876 | 3300010167 | Bacteria | 3064 |
| 43 | Ga0466707_144254 | 3300042601 | Bacteria | 2833 |
| 44 | Ga0466707_275640 | 3300042601 | Bacteria | 2229 |
| 45 | Ga0466713_031042 | 3300042602 | Bacteria | 43891 |
| 46 | Ga0466713_069301 | 3300042602 | Bacteria | 2539 |
| 47 | Ga0466713_144521 | 3300042602 | Bacteria | 6195 |
| 48 | Ga0466716_242200 | 3300042605 | Bacteria | 3031 |
| 49 | Ga0466716_523902 | 3300042605 | Bacteria | 10185 |
| 50 | Ga0466719_009256 | 3300042606 | Bacteria | 1451 |
| 51 | Ga0466719_108547 | 3300042606 | Bacteria | 1315 |
| 52 | Ga0466722_034317 | 3300042609 | Bacteria | 8767 |
| 53 | Ga0466722_215154 | 3300042609 | Bacteria | 5736 |
| 54 | HBC_ctgsDRAFT_1010722 | 3300000333 | Bacteria | 2185 |
| 55 | JGI24702J35022_10006068 | 3300002462 | Bacteria | 7016 |
| 56 | Ga0466692_028197 | 3300042591 | Bacteria | 36639 |
| 57 | Ga0466699_380294 | 3300042597 | Bacteria | 4395 |
| 58 | Ga0466734_167422 | 3300042623 | Bacteria | 1799 |
| 59 | Ga0466703_184110 | 3300042636 | Bacteria | 17468 |
| 60 | Ga0466709_272178 | 3300042648 | Bacteria | 11925 |
| 61 | Ga0466727_040611 | 3300042655 | Bacteria | 17818 |
| 62 | Ga0466705_307344 | 3300042612 | Bacteria | 4444 |
| 63 | Ga0562379_4125 | 3300056790 | Bacteria | 8024 |
| 64 | Ga0562377_0006 | 3300056842 | Bacteria | 3350072 |
| 65 | Ga0562377_0116 | 3300056842 | Bacteria | 251456 |
| 66 | Ga0466705_451082 | 3300042612 | Bacteria | 13208 |
| 67 | Ga0466705_530262 | 3300042612 | Bacteria | 15449 |
| 68 | Ga0466711_290017 | 3300042615 | Bacteria | 2501 |
| 69 | Ga0466711_454934 | 3300042615 | Bacteria | 2267 |
| 70 | Ga0466715_014306 | 3300042616 | Bacteria | 17032 |
| 71 | Ga0466715_124718 | 3300042616 | Bacteria | 5328 |
| 72 | Ga0466715_355315 | 3300042616 | Bacteria | 29846 |
| 73 | Ga0466723_206448 | 3300042618 | Bacteria | 6904 |
| 74 | Ga0466723_265313 | 3300042618 | Bacteria | 10361 |
| 75 | Ga0466728_149765 | 3300042620 | Bacteria | 2463 |
| 76 | Ga0466728_338401 | 3300042620 | Bacteria | 5902 |
| 77 | Ga0123357_10443483 | 3300009784 | Bacteria | 1134 |
| 78 | Ga0123356_10000159 | 3300010049 | Bacteria | 76638 |
| 79 | Ga0123356_10091820 | 3300010049 | Bacteria | 2895 |
| 80 | Ga0123353_10266418 | 3300010167 | Bacteria | 2643 |
| 81 | Ga0123353_10298586 | 3300010167 | Bacteria | 2460 |
| 82 | Ga0466700_375110 | 3300042600 | Bacteria | 2242 |
| 83 | Ga0466713_155069 | 3300042602 | Bacteria | 27732 |
| 84 | Ga0466716_265638 | 3300042605 | Bacteria | 2426 |
| 85 | Ga0466722_072243 | 3300042609 | Bacteria | 1998 |
| 86 | Ga0466692_009495 | 3300042591 | Bacteria | 2467 |
| 87 | Ga0466692_012763 | 3300042591 | Bacteria | 2564 |
| 88 | Ga0466692_114172 | 3300042591 | Bacteria | 3123 |
| 89 | Ga0466692_150410 | 3300042591 | Bacteria | 17592 |
| 90 | Ga0466692_196387 | 3300042591 | Bacteria | 11129 |
| 91 | Ga0466691_012610 | 3300042593 | Bacteria | 3145 |
| 92 | Ga0466691_026099 | 3300042593 | Bacteria | 6591 |
| 93 | Ga0466694_085525 | 3300042594 | Bacteria | 8244 |
| 94 | Ga0466703_160536 | 3300042636 | Bacteria | 1585 |
| 95 | Ga0466703_231354 | 3300042636 | Bacteria | 9110 |
| 96 | Ga0466725_139670 | 3300042654 | Bacteria | 26650 |
| 97 | Ga0466727_083863 | 3300042655 | Bacteria | 3180 |
| 98 | Ga0466705_029748 | 3300042612 | Bacteria | 29924 |
| 99 | Ga0562377_0032 | 3300056842 | Bacteria | 719749 |
| 100 | Ga0466711_407108 | 3300042615 | Bacteria | 25352 |
| 101 | Ga0466715_053704 | 3300042616 | Bacteria | 8151 |
| 102 | Ga0466715_317677 | 3300042616 | Bacteria | 11483 |
| 103 | Ga0466715_423547 | 3300042616 | Bacteria | 7205 |
| 104 | Ga0466723_302960 | 3300042618 | Bacteria | 5455 |
| 105 | Ga0466723_345586 | 3300042618 | Bacteria | 28546 |
| 106 | Ga0466728_074772 | 3300042620 | Bacteria | 25028 |
| 107 | Ga0466728_100155 | 3300042620 | Bacteria | 13880 |
| 108 | Ga0466728_188247 | 3300042620 | Bacteria | 7163 |
| 109 | Ga0123356_10399816 | 3300010049 | Bacteria | 1511 |
| 110 | Ga0123353_10000363 | 3300010167 | Bacteria | 55294 |
| 111 | Ga0123353_10424337 | 3300010167 | Bacteria | 1969 |
| 112 | Ga0123354_10173117 | 3300010882 | Bacteria | 2502 |
| 113 | Ga0466716_281343 | 3300042605 | Bacteria | 35094 |
| 114 | Ga0466716_503109 | 3300042605 | Bacteria | 1563 |
| 115 | Ga0466719_107925 | 3300042606 | Bacteria | 71556 |
| 116 | Ga0466719_265418 | 3300042606 | Bacteria | 9487 |
| 117 | Ga0068305_10064178 | 3300005083 | Bacteria | 19251 |
| 118 | Ga0415639_162365 | 3300038395 | Bacteria | 1516 |
| 119 | Ga0466696_142608 | 3300042596 | Bacteria | 17634 |
| 120 | Ga0466696_196884 | 3300042596 | Bacteria | 2342 |
| 121 | Ga0466704_395306 | 3300042643 | Bacteria | 11867 |
| 122 | Ga0466709_162687 | 3300042648 | Bacteria | 2002 |
| 123 | Ga0466709_247797 | 3300042648 | Bacteria | 14309 |
| 124 | Ga0466709_408454 | 3300042648 | Bacteria | 2679 |
| 125 | Ga0466708_217021 | 3300042652 | Bacteria | 11084 |
| 126 | Ga0466708_367899 | 3300042652 | Bacteria | 11069 |
| 127 | Ga0466727_085783 | 3300042655 | Bacteria | 2750 |
| 128 | Ga0562378_1586 | 3300056814 | Bacteria | 23831 |
| 129 | Ga0466711_109213 | 3300042615 | Bacteria | 5522 |
| 130 | Ga0466723_130005 | 3300042618 | Bacteria | 6312 |
| 131 | Ga0466726_417794 | 3300042619 | Bacteria | 15594 |
| 132 | Ga0123353_10026517 | 3300010167 | Bacteria | 8854 |
| 133 | Ga0123353_10068439 | 3300010167 | Bacteria | 5702 |
| 134 | Ga0466700_490941 | 3300042600 | Bacteria | 1624 |
| 135 | Ga0466722_052746 | 3300042609 | Bacteria | 2768 |
| 136 | Ga0466722_138276 | 3300042609 | Bacteria | 8457 |
| 137 | Ga0466691_110483 | 3300042593 | Bacteria | 9774 |
| 138 | Ga0466691_132588 | 3300042593 | Unclassified | 9381 |
| 139 | Ga0466694_194961 | 3300042594 | Bacteria | 2027 |
| 140 | Ga0466699_009059 | 3300042597 | Bacteria | 1222 |
| 141 | Ga0466703_025134 | 3300042636 | Bacteria | 9771 |
| 142 | Ga0466703_025704 | 3300042636 | Bacteria | 95958 |
| 143 | Ga0466703_252723 | 3300042636 | Bacteria | 1204 |
| 144 | Ga0466704_196803 | 3300042643 | Bacteria | 9083 |
| 145 | Ga0466704_460917 | 3300042643 | Bacteria | 1490 |
| 146 | Ga0466709_415005 | 3300042648 | Bacteria | 5181 |
| 147 | Ga0466708_049912 | 3300042652 | Bacteria | 10244 |
| 148 | Ga0466708_344385 | 3300042652 | Bacteria | 15703 |
| 149 | Ga0466727_294642 | 3300042655 | Bacteria | 4936 |
| 150 | Ga0466733_077622 | 3300042659 | Bacteria | 5635 |
| 151 | Ga0466711_217391 | 3300042615 | Bacteria | 9283 |
| 152 | Ga0466715_155053 | 3300042616 | Bacteria | 3922 |
| 153 | Ga0466723_071185 | 3300042618 | Bacteria | 53854 |
| 154 | Ga0466723_081364 | 3300042618 | Bacteria | 1743 |
| 155 | Ga0466723_118884 | 3300042618 | Bacteria | 8357 |
| 156 | Ga0466723_244521 | 3300042618 | Bacteria | 1258 |
| 157 | Ga0466729_042239 | 3300042621 | Bacteria | 1263 |
| 158 | Ga0123353_10133264 | 3300010167 | Bacteria | 3986 |
| 159 | Ga0123353_10273438 | 3300010167 | Bacteria | 2601 |
| 160 | Ga0123354_10282162 | 3300010882 | Bacteria | 1610 |
| 161 | Ga0466707_124223 | 3300042601 | Bacteria | 1986 |
| 162 | Ga0466707_207722 | 3300042601 | Bacteria | 1817 |
| 163 | Ga0466719_195436 | 3300042606 | Bacteria | 3630 |
| 164 | Ga0466719_374254 | 3300042606 | Bacteria | 1585 |
| 165 | Ga0466722_101044 | 3300042609 | Bacteria | 26620 |
| 166 | Ga0103261_1000127 | 3300007083 | Bacteria | 13703 |
| 167 | Ga0160467_100820 | 3300012829 | Bacteria | 20521 |
| 168 | Ga0466690_102575 | 3300042590 | Bacteria | 4794 |
| 169 | Ga0466692_125830 | 3300042591 | Bacteria | 7652 |
| 170 | Ga0466691_128646 | 3300042593 | Bacteria | 4492 |
| 171 | Ga0466691_223761 | 3300042593 | Bacteria | 5809 |
| 172 | Ga0466696_015364 | 3300042596 | Bacteria | 2765 |
| 173 | Ga0466696_355083 | 3300042596 | Bacteria | 1562 |
| 174 | Ga0466703_286279 | 3300042636 | Bacteria | 10150 |
| 175 | Ga0466708_071796 | 3300042652 | Bacteria | 29991 |
| 176 | Ga0466727_039162 | 3300042655 | Bacteria | 3326 |
| 177 | Ga0466705_139809 | 3300042612 | Bacteria | 6010 |
| 178 | Ga0466705_272629 | 3300042612 | Bacteria | 3467 |
| 179 | Ga0466705_361086 | 3300042612 | Bacteria | 10774 |
| 180 | Ga0466715_271327 | 3300042616 | Bacteria | 5776 |
| 181 | Ga0466723_020897 | 3300042618 | Bacteria | 12114 |
| 182 | Ga0466726_108273 | 3300042619 | Bacteria | 13843 |
| 183 | Ga0466726_356517 | 3300042619 | Bacteria | 1906 |
| 184 | Ga0466728_392290 | 3300042620 | Bacteria | 5830 |
| 185 | Ga0123353_10475914 | 3300010167 | Bacteria | 1829 |
| 186 | Ga0466707_189295 | 3300042601 | Bacteria | 2697 |
| 187 | Ga0466713_023073 | 3300042602 | Bacteria | 2681 |
| 188 | Ga0466713_123212 | 3300042602 | Bacteria | 27535 |
| 189 | Ga0466714_113757 | 3300042603 | Bacteria | 25649 |
| 190 | Ga0466716_450831 | 3300042605 | Bacteria | 3355 |
| 191 | Ga0466719_028049 | 3300042606 | Bacteria | 40680 |
| 192 | Ga0466690_319698 | 3300042590 | Bacteria | 3270 |
| 193 | Ga0466729_199723 | 3300042621 | Bacteria | 2629 |
| 194 | Ga0466735_124887 | 3300042624 | Bacteria | 2809 |
| 195 | Ga0466703_175390 | 3300042636 | Bacteria | 5827 |
| 196 | Ga0466703_359767 | 3300042636 | Bacteria | 11456 |
| 197 | Ga0466704_111402 | 3300042643 | Bacteria | 4513 |
| 198 | Ga0466704_136272 | 3300042643 | Bacteria | 9832 |
| 199 | Ga0466704_235144 | 3300042643 | Bacteria | 29659 |
| 200 | Ga0466727_116187 | 3300042655 | Bacteria | 2224 |
| 201 | Ga0466727_138091 | 3300042655 | Bacteria | 14986 |
| 202 | Ga0466727_140581 | 3300042655 | Bacteria | 1696 |
| 203 | Ga0466705_080637 | 3300042612 | Bacteria | 18662 |
| 204 | Ga0466705_189441 | 3300042612 | Bacteria | 18281 |
| 205 | Ga0466711_325391 | 3300042615 | Bacteria | 4005 |
| 206 | Ga0466711_509294 | 3300042615 | Bacteria | 2427 |
| 207 | Ga0466715_127815 | 3300042616 | Bacteria | 21986 |
| 208 | Ga0466726_012027 | 3300042619 | Bacteria | 8992 |
| 209 | Ga0466726_415196 | 3300042619 | Bacteria | 3615 |
| 210 | Ga0466728_075597 | 3300042620 | Bacteria | 10227 |
| 211 | Ga0466728_193917 | 3300042620 | Bacteria | 2618 |
| 212 | Ga0466728_198042 | 3300042620 | Bacteria | 6727 |
| 213 | Ga0123356_10374930 | 3300010049 | Bacteria | 1554 |
| 214 | Ga0466714_016300 | 3300042603 | Bacteria | 6264 |
| 215 | Ga0466716_074438 | 3300042605 | Bacteria | 33435 |
| 216 | Ga0466719_029564 | 3300042606 | Bacteria | 1723 |
| 217 | Ga0466719_093042 | 3300042606 | Bacteria | 19229 |
| 218 | Ga0466719_138171 | 3300042606 | Bacteria | 15082 |
| 219 | Ga0466722_088593 | 3300042609 | Bacteria | 9190 |
| 220 | Ga0068305_10217170 | 3300005083 | Bacteria | 12650 |
| 221 | Ga0072940_1216037 | 3300005200 | Bacteria | 2743 |
| 222 | Ga0466690_002266 | 3300042590 | Bacteria | 8722 |
| 223 | Ga0466692_204421 | 3300042591 | Bacteria | 1962 |
| 224 | Ga0466691_047239 | 3300042593 | Bacteria | 3082 |
| 225 | Ga0466691_096001 | 3300042593 | Bacteria | 21232 |
| 226 | Ga0466691_136109 | 3300042593 | Bacteria | 3249 |
| 227 | Ga0466703_013158 | 3300042636 | Bacteria | 12942 |
| 228 | Ga0466703_158424 | 3300042636 | Bacteria | 2022 |
| 229 | Ga0466704_175916 | 3300042643 | Bacteria | 3023 |
| 230 | Ga0466704_203100 | 3300042643 | Bacteria | 3169 |
| 231 | Ga0466704_248751 | 3300042643 | Unclassified | 6608 |
| 232 | Ga0466704_296244 | 3300042643 | Bacteria | 11172 |
| 233 | Ga0466709_110753 | 3300042648 | Bacteria | 4352 |
| 234 | Ga0466708_033882 | 3300042652 | Bacteria | 14921 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01408 | GO:0000166 | nucleotide binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.