Protein Family IF04952

Metagenome
110 Members
18 Samples
110 Scaffolds
344.62 Avg Length

🧬 Representative Sequence

ID
3300042593|Ga0466691_216086|Ga0466691_216086_7447_8577
Length
376 aa
Sequence
MRKNRNEGAFDTNLVFTILAHMLYTSSQMTVKDIAELAKVSIGTVDRVICHRGRVSAETKSRIEAIIEKYHFTPNPMARRLGRNRAYQFCAFLPRRDLDAGYWRQALEGIQEGAAEIAPFGVETKVVEFDRYSVRGISRAADSMLAVKPDGIILSPIMPETIKKVIEKIRQSGIPCVFFDTDLAGNDSLCSIGQDSFRGGYLAGRLMHLFAGKIVKPLAVLNAYGGGGASHRNGFLHYAGEHGFSTVVREYPDNAGAEIPVAEIALFLKENPNLAGIFITNCMAYRVVDAVKRQKGRRTFVLVGYDLIPKNRELLQEGAIDAVISRHLKEQGRLALLNLYRHVALEQRILPKIQMPLDVYFRENIPIIDEPFSEPG

📊 Sample Types

Isolate 0.0%
Metagenome 100.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 77.8%
Rhinotermitidae 11.1%
Termopsidae 11.1%

🌳 Taxonomy

Archaea 0
Bacteria 95
Eukaryota 0
Viruses 0
Unclassified 15

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
3 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
4 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
5 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
6 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
7 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
8 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
9 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
10 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
11 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
15 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
16 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
17 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466723_037688 3300042618 Bacteria 12902
2 Ga0466690_042691 3300042590 Bacteria 6692
3 Ga0466691_147183 3300042593 Bacteria 7273
4 Ga0466696_026400 3300042596 Bacteria 2413
5 Ga0466716_124474 3300042605 Bacteria 11233
6 Ga0466719_148376 3300042606 Bacteria 23878
7 Ga0466719_398649 3300042606 Bacteria 3170
8 Ga0466735_013867 3300042624 Bacteria 2187
9 Ga0466704_541371 3300042643 Bacteria 4044
10 Ga0466709_222295 3300042648 Bacteria 4438
11 Ga0466708_307553 3300042652 Unclassified 1400
12 Ga0466705_200268 3300042612 Unclassified 2509
13 Ga0466711_247388 3300042615 Bacteria 6057
14 Ga0466715_112123 3300042616 Bacteria 2943
15 Ga0466715_409418 3300042616 Bacteria 10328
16 Ga0466728_030260 3300042620 Bacteria 7680
17 Ga0466728_099429 3300042620 Bacteria 2270
18 Ga0466728_296476 3300042620 Bacteria 21133
19 Ga0466691_025092 3300042593 Bacteria 5755
20 Ga0466691_027677 3300042593 Bacteria 11838
21 Ga0466691_154334 3300042593 Unclassified 1409
22 Ga0466719_087401 3300042606 Bacteria 2772
23 Ga0466703_083109 3300042636 Bacteria 27128
24 Ga0466704_069702 3300042643 Bacteria 8027
25 Ga0466704_227398 3300042643 Bacteria 4794
26 Ga0466709_245464 3300042648 Bacteria 6429
27 Ga0466708_021884 3300042652 Bacteria 5256
28 Ga0466708_151108 3300042652 Bacteria 1459
29 Ga0466708_390066 3300042652 Bacteria 6426
30 Ga0466705_258676 3300042612 Bacteria 1494
31 Ga0466715_103403 3300042616 Unclassified 7331
32 Ga0466690_114443 3300042590 Bacteria 6391
33 Ga0466692_150237 3300042591 Bacteria 2097
34 Ga0466691_060532 3300042593 Bacteria 4775
35 Ga0466716_329176 3300042605 Unclassified 1419
36 Ga0466735_084597 3300042624 Bacteria 3021
37 Ga0466703_384731 3300042636 Bacteria 3383
38 Ga0466704_384947 3300042643 Bacteria 2645
39 Ga0466704_432880 3300042643 Bacteria 2165
40 Ga0466709_082359 3300042648 Bacteria 15275
41 Ga0466708_127647 3300042652 Bacteria 4848
42 Ga0466715_047758 3300042616 Bacteria 2664
43 Ga0466715_309481 3300042616 Bacteria 4116
44 Ga0466726_157224 3300042619 Bacteria 4941
45 Ga0466726_221848 3300042619 Bacteria 5827
46 Ga0466728_105629 3300042620 Bacteria 2481
47 Ga0466728_148029 3300042620 Bacteria 3078
48 Ga0466728_315770 3300042620 Unclassified 1907
49 Ga0466690_043284 3300042590 Unclassified 1632
50 Ga0466691_176956 3300042593 Bacteria 7363
51 Ga0466716_308186 3300042605 Bacteria 13341
52 Ga0466716_414063 3300042605 Bacteria 4376
53 Ga0466735_033006 3300042624 Bacteria 14657
54 Ga0466735_195268 3300042624 Bacteria 2016
55 Ga0466703_220845 3300042636 Bacteria 51302
56 Ga0466703_417786 3300042636 Unclassified 1623
57 Ga0466704_434612 3300042643 Unclassified 2052
58 Ga0466708_246011 3300042652 Bacteria 47079
59 Ga0466708_296635 3300042652 Bacteria 5654
60 Ga0466715_297810 3300042616 Bacteria 7497
61 Ga0466728_030168 3300042620 Bacteria 5699
62 Ga0466735_038733 3300042624 Bacteria 2062
63 Ga0466703_021933 3300042636 Bacteria 10429
64 Ga0466703_174837 3300042636 Bacteria 5045
65 Ga0466715_285631 3300042616 Bacteria 3026
66 Ga0466723_076745 3300042618 Bacteria 2299
67 Ga0466690_004660 3300042590 Bacteria 13152
68 Ga0466690_100604 3300042590 Bacteria 16776
69 Ga0466690_383917 3300042590 Bacteria 7607
70 Ga0466691_004931 3300042593 Bacteria 5907
71 Ga0466691_228304 3300042593 Unclassified 1932
72 Ga0466696_069124 3300042596 Bacteria 1726
73 Ga0466696_077965 3300042596 Bacteria 5346
74 Ga0466696_170640 3300042596 Bacteria 2893
75 Ga0466719_551871 3300042606 Unclassified 2091
76 Ga0466729_215946 3300042621 Bacteria 4975
77 Ga0466704_058209 3300042643 Bacteria 9061
78 Ga0466704_099774 3300042643 Bacteria 4950
79 Ga0466709_335438 3300042648 Bacteria 1969
80 Ga0466709_393239 3300042648 Bacteria 9938
81 Ga0466708_279250 3300042652 Bacteria 1673
82 Ga0466708_380060 3300042652 Unclassified 1306
83 Ga0466711_070999 3300042615 Bacteria 2504
84 Ga0466715_074838 3300042616 Bacteria 2964
85 Ga0466728_220532 3300042620 Bacteria 2728
86 Ga0466690_029753 3300042590 Bacteria 3519
87 Ga0466691_216086 3300042593 Bacteria 33762
88 Ga0466696_059008 3300042596 Bacteria 4706
89 Ga0466719_124128 3300042606 Unclassified 1093
90 Ga0466719_191341 3300042606 Bacteria 15353
91 Ga0466719_218126 3300042606 Unclassified 2118
92 Ga0466719_250034 3300042606 Bacteria 2296
93 Ga0466735_153301 3300042624 Bacteria 1669
94 Ga0466704_081528 3300042643 Bacteria 3987
95 Ga0466704_307071 3300042643 Bacteria 2260
96 Ga0466705_175211 3300042612 Bacteria 3939
97 Ga0466715_638735 3300042616 Bacteria 3466
98 Ga0466723_080312 3300042618 Bacteria 4059
99 Ga0466723_133500 3300042618 Bacteria 2769
100 Ga0466723_349016 3300042618 Bacteria 7365
101 Ga0466692_036448 3300042591 Bacteria 3607
102 Ga0466691_087942 3300042593 Bacteria 1661
103 Ga0466691_221998 3300042593 Bacteria 17632
104 Ga0466719_483427 3300042606 Bacteria 5143
105 Ga0466703_010347 3300042636 Bacteria 7447
106 Ga0466703_378465 3300042636 Bacteria 1359
107 Ga0466704_164287 3300042643 Unclassified 2090
108 Ga0466709_015422 3300042648 Bacteria 14930
109 Ga0466709_100557 3300042648 Bacteria 7576
110 Ga0466708_091453 3300042652 Bacteria 19162

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00356 LacI Bacterial regulatory proteins, lacI family 30 75 0.99
PF13407 Peripla_BP_4 Periplasmic binding protein domain 99 343 0.86
PF00532 Peripla_BP_1 Periplasmic binding proteins and sugar binding domain of LacI family 96 348 0.72

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.