Protein Family IF04932
Metagenome
Isolate
146
Members
41
Samples
142
Scaffolds
210.74
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_167459|Ga0466691_167459_4910_5683
- Length
- 257 aa
- Sequence
- MNLFQKSRVIGRRVPYPGACSEKFTGCGKENTRELAPWSLRGFGPNDKANAQAPQAPGFFIVFCLFFTVVFAGADTFTFKADKMSGTKSLGKEVTVLAGNAEVRSDNLLLRAEKIELQGDDNQFIDCTGGVSGVEEEKEIFFQTDRLRYDRNLKIVRLEGNSSLEDRKNELVARGRFIEYDEDAEVTVFQISVRLFKDDMVCRSEYAIYRRDEKLLDLSGFPVVFKKDDEFRADRIRVDLDTDDVTMEGAVSGTIKN
Sample Types
Isolate
2.7%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.0%
Kalotermitidae
33.3%
Unclassified
12.8%
Termopsidae
7.7%
Rhinotermitidae
5.1%
Taxonomy
Archaea
0
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 20 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 24 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 36 | 2781125689 | Treponema sp. Mp193P4bin9 | Isolate | Unclassified |
| 37 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 38 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 39 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 40 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 41 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10040221 | 3300002449 | Bacteria | 2415 |
| 2 | JGI24698J34947_10063317 | 3300002449 | Bacteria | 1813 |
| 3 | JGI24698J34947_10187292 | 3300002449 | Unclassified | 822 |
| 4 | Ga0072940_1034211 | 3300005200 | Unclassified | 4766 |
| 5 | Ga0466712_131056 | 3300042614 | Bacteria | 5269 |
| 6 | Ga0466712_202924 | 3300042614 | Bacteria | 1088 |
| 7 | Ga0466718_077322 | 3300042617 | Bacteria | 31469 |
| 8 | Ga0466726_136866 | 3300042619 | Bacteria | 2418 |
| 9 | Ga0466716_080549 | 3300042605 | Bacteria | 1998 |
| 10 | Ga0466719_097957 | 3300042606 | Bacteria | 9149 |
| 11 | Ga0466719_440447 | 3300042606 | Bacteria | 1883 |
| 12 | Ga0466720_156820 | 3300042607 | Bacteria | 42318 |
| 13 | Ga0264413_118397 | 3300024493 | Bacteria | 8722 |
| 14 | Ga0466690_299408 | 3300042590 | Unclassified | 2652 |
| 15 | Ga0466699_325633 | 3300042597 | Bacteria | 1574 |
| 16 | Ga0466699_443203 | 3300042597 | Bacteria | 2141 |
| 17 | Ga0466729_267593 | 3300042621 | Bacteria | 1465 |
| 18 | Ga0466704_075647 | 3300042643 | Bacteria | 38985 |
| 19 | Ga0466704_436704 | 3300042643 | Bacteria | 9755 |
| 20 | Ga0466732_286468 | 3300042656 | Bacteria | 4128 |
| 21 | JGI24695J34938_10074074 | 3300002450 | Bacteria | 1417 |
| 22 | Ga0072941_1094934 | 3300005201 | Bacteria | 3452 |
| 23 | Ga0123356_11036671 | 3300010049 | Bacteria | 990 |
| 24 | Ga0466712_054577 | 3300042614 | Bacteria | 2296 |
| 25 | Ga0466712_270477 | 3300042614 | Unclassified | 1683 |
| 26 | Ga0466712_278704 | 3300042614 | Unclassified | 2265 |
| 27 | Ga0466712_319777 | 3300042614 | Bacteria | 3790 |
| 28 | Ga0466715_054597 | 3300042616 | Bacteria | 9400 |
| 29 | Ga0466723_131034 | 3300042618 | Bacteria | 7476 |
| 30 | Ga0466723_161004 | 3300042618 | Bacteria | 4304 |
| 31 | Ga0466707_378841 | 3300042601 | Bacteria | 1417 |
| 32 | Ga0466691_167459 | 3300042593 | Bacteria | 6522 |
| 33 | Ga0466694_190199 | 3300042594 | Bacteria | 1020 |
| 34 | Ga0466735_026118 | 3300042624 | Bacteria | 1418 |
| 35 | Ga0466702_142393 | 3300042635 | Bacteria | 1395 |
| 36 | Ga0466708_336065 | 3300042652 | Bacteria | 1460 |
| 37 | AustNasuHG_c1001457 | 3300000089 | Bacteria | 8487 |
| 38 | JGI24698J34947_10040007 | 3300002449 | Bacteria | 2424 |
| 39 | JGI24702J35022_10009872 | 3300002462 | Bacteria | 5349 |
| 40 | Ga0466712_001726 | 3300042614 | Bacteria | 1374 |
| 41 | Ga0466711_020200 | 3300042615 | Bacteria | 1792 |
| 42 | Ga0466718_049821 | 3300042617 | Bacteria | 16731 |
| 43 | Ga0466723_091625 | 3300042618 | Bacteria | 45311 |
| 44 | Ga0466726_112945 | 3300042619 | Bacteria | 3298 |
| 45 | Ga0466719_230241 | 3300042606 | Bacteria | 5352 |
| 46 | Ga0466719_323035 | 3300042606 | Unclassified | 2691 |
| 47 | Ga0466720_156019 | 3300042607 | Bacteria | 55009 |
| 48 | Ga0466722_098359 | 3300042609 | Bacteria | 8223 |
| 49 | Ga0466694_338186 | 3300042594 | Bacteria | 1276 |
| 50 | Ga0466735_207182 | 3300042624 | Bacteria | 1469 |
| 51 | Ga0466735_235761 | 3300042624 | Bacteria | 1638 |
| 52 | Ga0466703_048884 | 3300042636 | Bacteria | 1025 |
| 53 | Ga0466704_556490 | 3300042643 | Unclassified | 9507 |
| 54 | Ga0466705_013545 | 3300042612 | Bacteria | 34726 |
| 55 | AustNasuHG_c1016091 | 3300000089 | Bacteria | 2509 |
| 56 | JGI24698J34947_10028717 | 3300002449 | Bacteria | 2944 |
| 57 | JGI24698J34947_10032547 | 3300002449 | Bacteria | 2737 |
| 58 | Ga0072940_1028550 | 3300005200 | Bacteria | 1599 |
| 59 | Ga0072940_1029483 | 3300005200 | Bacteria | 4989 |
| 60 | Ga0072941_1088034 | 3300005201 | Unclassified | 3000 |
| 61 | Ga0466705_500351 | 3300042612 | Bacteria | 5302 |
| 62 | Ga0466712_104446 | 3300042614 | Bacteria | 2035 |
| 63 | Ga0466712_176269 | 3300042614 | Bacteria | 2775 |
| 64 | Ga0466711_466883 | 3300042615 | Bacteria | 3610 |
| 65 | Ga0466715_049424 | 3300042616 | Bacteria | 22983 |
| 66 | Ga0466718_036935 | 3300042617 | Bacteria | 1398 |
| 67 | Ga0466723_122113 | 3300042618 | Bacteria | 2355 |
| 68 | Ga0466726_049170 | 3300042619 | Bacteria | 3814 |
| 69 | Ga0466729_154315 | 3300042621 | Bacteria | 2192 |
| 70 | Ga0466690_151698 | 3300042590 | Unclassified | 1814 |
| 71 | Ga0466699_229634 | 3300042597 | Bacteria | 1869 |
| 72 | Ga0466704_025536 | 3300042643 | Bacteria | 1862 |
| 73 | Ga0466727_317027 | 3300042655 | Unclassified | 2304 |
| 74 | Ga0466732_013759 | 3300042656 | Bacteria | 5713 |
| 75 | JGI24698J34947_10053637 | 3300002449 | Bacteria | 2017 |
| 76 | JGI24698J34947_10062188 | 3300002449 | Bacteria | 1834 |
| 77 | JGI24695J34938_10000312 | 3300002450 | Bacteria | 48010 |
| 78 | Ga0466711_082314 | 3300042615 | Bacteria | 15048 |
| 79 | Ga0466715_307992 | 3300042616 | Bacteria | 19266 |
| 80 | Ga0466723_217966 | 3300042618 | Bacteria | 58279 |
| 81 | Ga0466728_108887 | 3300042620 | Bacteria | 19171 |
| 82 | Ga0466728_386367 | 3300042620 | Bacteria | 2519 |
| 83 | Ga0466729_082796 | 3300042621 | Bacteria | 1523 |
| 84 | Ga0466700_305694 | 3300042600 | Bacteria | 2543 |
| 85 | Ga0466707_042544 | 3300042601 | Bacteria | 1377 |
| 86 | Ga0466719_021371 | 3300042606 | Bacteria | 3244 |
| 87 | Ga0466719_161698 | 3300042606 | Bacteria | 6995 |
| 88 | Ga0466690_137111 | 3300042590 | Bacteria | 4280 |
| 89 | Ga0466694_263752 | 3300042594 | Bacteria | 11563 |
| 90 | Ga0466708_155385 | 3300042652 | Bacteria | 20713 |
| 91 | JGI24698J34947_10008360 | 3300002449 | Bacteria | 5680 |
| 92 | JGI24700J35501_10913088 | 3300002508 | Bacteria | 3734 |
| 93 | Ga0072940_1028551 | 3300005200 | Bacteria | 1724 |
| 94 | Ga0072941_1018183 | 3300005201 | Bacteria | 13561 |
| 95 | Ga0123356_10004055 | 3300010049 | Bacteria | 15207 |
| 96 | Ga0123353_10404281 | 3300010167 | Unclassified | 2031 |
| 97 | Ga0466715_056679 | 3300042616 | Bacteria | 7310 |
| 98 | Ga0466723_259470 | 3300042618 | Bacteria | 15035 |
| 99 | Ga0466726_036673 | 3300042619 | Bacteria | 3785 |
| 100 | Ga0466728_450943 | 3300042620 | Bacteria | 3773 |
| 101 | Ga0264413_105871 | 3300024493 | Unclassified | 8882 |
| 102 | Ga0264413_113807 | 3300024493 | Bacteria | 6422 |
| 103 | Ga0466691_049059 | 3300042593 | Bacteria | 2902 |
| 104 | Ga0466699_211706 | 3300042597 | Bacteria | 1667 |
| 105 | Ga0466727_025973 | 3300042655 | Bacteria | 4305 |
| 106 | Ga0466727_274563 | 3300042655 | Bacteria | 3453 |
| 107 | Ga0466732_078386 | 3300042656 | Bacteria | 4962 |
| 108 | Ga0466732_099962 | 3300042656 | Bacteria | 27941 |
| 109 | Ga0466732_178103 | 3300042656 | Bacteria | 2640 |
| 110 | JGI24698J34947_10012110 | 3300002449 | Bacteria | 4733 |
| 111 | JGI24698J34947_10066005 | 3300002449 | Unclassified | 1762 |
| 112 | Ga0072941_1005447 | 3300005201 | Bacteria | 2523 |
| 113 | Ga0072941_1053332 | 3300005201 | Bacteria | 9150 |
| 114 | Ga0466712_009227 | 3300042614 | Bacteria | 27493 |
| 115 | Ga0466723_277179 | 3300042618 | Unclassified | 3608 |
| 116 | Ga0466726_171990 | 3300042619 | Bacteria | 2252 |
| 117 | Ga0466729_140982 | 3300042621 | Bacteria | 4169 |
| 118 | Ga0466719_342770 | 3300042606 | Bacteria | 1634 |
| 119 | Ga0466696_011300 | 3300042596 | Bacteria | 1794 |
| 120 | Ga0466696_117170 | 3300042596 | Bacteria | 10079 |
| 121 | Ga0466735_114114 | 3300042624 | Bacteria | 1517 |
| 122 | Ga0466703_119488 | 3300042636 | Bacteria | 16381 |
| 123 | Ga0466708_014496 | 3300042652 | Bacteria | 11641 |
| 124 | Ga0466727_119843 | 3300042655 | Bacteria | 2599 |
| 125 | Ga0466732_452543 | 3300042656 | Unclassified | 2009 |
| 126 | AustNasuHG_c1007365 | 3300000089 | Bacteria | 3917 |
| 127 | JGI24698J34947_10020590 | 3300002449 | Unclassified | 3551 |
| 128 | JGI24698J34947_10129335 | 3300002449 | Bacteria | 1082 |
| 129 | JGI24695J34938_10030645 | 3300002450 | Bacteria | 2503 |
| 130 | Ga0072941_1003572 | 3300005201 | Bacteria | 38999 |
| 131 | Ga0123356_10979658 | 3300010049 | Bacteria | 1016 |
| 132 | Ga0123353_10099915 | 3300010167 | Bacteria | 4676 |
| 133 | Ga0466712_236957 | 3300042614 | Bacteria | 1420 |
| 134 | Ga0466715_411752 | 3300042616 | Bacteria | 6519 |
| 135 | Ga0466715_515432 | 3300042616 | Bacteria | 4668 |
| 136 | Ga0466718_102600 | 3300042617 | Bacteria | 17725 |
| 137 | Ga0466718_156218 | 3300042617 | Bacteria | 1497 |
| 138 | Ga0466720_053175 | 3300042607 | Bacteria | 7154 |
| 139 | Ga0466720_119821 | 3300042607 | Bacteria | 22326 |
| 140 | Ga0466722_240272 | 3300042609 | Bacteria | 1958 |
| 141 | Ga0466735_086522 | 3300042624 | Bacteria | 1646 |
| 142 | Ga0466708_347870 | 3300042652 | Unclassified | 2257 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.