Protein Family IF04855
Metagenome
Isolate
220
Members
43
Samples
199
Scaffolds
873.36
Avg Length
Representative Sequence
- ID
- 3300042593|Ga0466691_045101|Ga0466691_045101_6252_9200
- Length
- 982 aa
- Sequence
- MFIDGLYTILIEPIIQIIEVIFMIFSRMLNNGMAVVVVSVAISLLTHPFYMMAEKWRQVERGTQARLARKLRVIKSVFSGDERHLLITACYRQNHYHPVYGLRNSIGLFIQIPFFMAAYICLSNLQVLKGEPFLFIKDLGMPDALIPLWGGVNLLPIVMTLVNCAAAAVYTKGLPKKDAAQLYLMAAVFLALLYDSPAGLVLYWTCNNLFSLAKNIALRVSNSTNKGGSLPLTPAPQAGLPLPPLRGDSPPQRPPSPIPXEGPAPEGIIDAPPPFPAFGEMENMSSSIFDSPVGGYRRNLPLRRHQGKPLWGLVCAVSLSAAFYLLFIFDKGYYVKRAALSGCFILVCFFPAFAALARKIERKYVPASLYAARNGPLFAASALILWVLAGIAIPSGLIGSSVEEFSFIEPFASPVPFVSRTALQAAGIFLLWPAVVYALFSPKVRFYGTLFLAAAGFIALLDTYLFAGNYGYLTITLTLSNDEFSQPFFIVLLEIALVVLAAVGAALLFIRKRKWLFSVQIIALLSLCAFSVFNIVKIQRDFTRYRGMAVESEETLTPVFTFSKTENNVLVVMLDRALSPFIPTIFAEKPELNETLSGFTWYPNCVSLGPVTISAVPSLFGGYEYAPALMGTNNGTPLVEKHNEALLVMPRVFSEHGFRVTVSDPSWANYNYKSDISIYEPYPAIDAVKIIGKYTKHWLEKNRDVRVFDASAFLQYNLLRFSFLRIAPPFLRFFVYDGGRWLAKIGETNRDFSLLTLDEYTALDVLPEITAVDEGEGTLAIITNQLTHEPAFLQAPAYRPAAAVTDRGSGPYAGDAAYHANIAALLLLSRYFAWLKEHDAYDNTRIIITADHGWGSQHDFEGNITLPNGKALVNYNPLYLVKDFNARGPLAVDQSFMTNADTPSLAVEGLIPDPRNPWTGNPIQPDKDNGVTITTSGSWSPDGHAKYAFKIAEDEYLTVHTDIFDPANWSKGKKPTDETDDP
Sample Types
Isolate
3.6%
Metagenome
96.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
34.1%
Kalotermitidae
34.1%
Unclassified
19.5%
Termopsidae
7.3%
Rhinotermitidae
4.9%
Taxonomy
Archaea
2
Bacteria
204
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 2 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 3 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 4 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 7 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 8 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 9 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 18 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 21 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 22 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 23 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 24 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 33 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 34 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 35 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 36 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 37 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 38 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 39 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 40 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 41 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 42 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 43 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_015287 | 3300042612 | Unclassified | 4693 |
| 2 | Ga0466705_092431 | 3300042612 | Bacteria | 6347 |
| 3 | Ga0466712_035081 | 3300042614 | Bacteria | 3474 |
| 4 | Ga0466712_041086 | 3300042614 | Bacteria | 62732 |
| 5 | Ga0466718_084538 | 3300042617 | Bacteria | 33255 |
| 6 | Ga0466718_140960 | 3300042617 | Unclassified | 8940 |
| 7 | Ga0466723_031628 | 3300042618 | Bacteria | 5931 |
| 8 | Ga0466726_041373 | 3300042619 | Bacteria | 9559 |
| 9 | Ga0466703_415986 | 3300042636 | Bacteria | 11759 |
| 10 | Ga0466704_099081 | 3300042643 | Bacteria | 4266 |
| 11 | Ga0466704_141731 | 3300042643 | Bacteria | 11972 |
| 12 | Ga0466704_173000 | 3300042643 | Bacteria | 13906 |
| 13 | Ga0466704_230269 | 3300042643 | Bacteria | 3428 |
| 14 | Ga0466708_009550 | 3300042652 | Bacteria | 10521 |
| 15 | Ga0264413_104712 | 3300024493 | Bacteria | 9960 |
| 16 | Ga0264413_125211 | 3300024493 | Bacteria | 3845 |
| 17 | Ga0466692_191219 | 3300042591 | Bacteria | 3606 |
| 18 | Ga0466691_008291 | 3300042593 | Bacteria | 7329 |
| 19 | Ga0466691_045101 | 3300042593 | Bacteria | 10425 |
| 20 | Ga0466694_032428 | 3300042594 | Unclassified | 38124 |
| 21 | Ga0466694_061177 | 3300042594 | Bacteria | 10878 |
| 22 | Ga0466696_154937 | 3300042596 | Bacteria | 5418 |
| 23 | Ga0466720_178419 | 3300042607 | Bacteria | 5234 |
| 24 | Ga0466722_201715 | 3300042609 | Bacteria | 28386 |
| 25 | JGI24698J34947_10000289 | 3300002449 | Bacteria | 21802 |
| 26 | JGI24698J34947_10001753 | 3300002449 | Bacteria | 11562 |
| 27 | JGI24698J34947_10025888 | 3300002449 | Bacteria | 3120 |
| 28 | Ga0072941_1019085 | 3300005201 | Bacteria | 32127 |
| 29 | Ga0072941_1036072 | 3300005201 | Bacteria | 7680 |
| 30 | Ga0072941_1069815 | 3300005201 | Bacteria | 5074 |
| 31 | Ga0466705_169004 | 3300042612 | Bacteria | 3303 |
| 32 | Ga0466712_030357 | 3300042614 | Bacteria | 33145 |
| 33 | Ga0466712_118468 | 3300042614 | Bacteria | 28270 |
| 34 | Ga0466712_187386 | 3300042614 | Bacteria | 4864 |
| 35 | Ga0466718_099267 | 3300042617 | Bacteria | 15781 |
| 36 | Ga0466723_036192 | 3300042618 | Bacteria | 13182 |
| 37 | Ga0466726_287333 | 3300042619 | Bacteria | 3413 |
| 38 | Ga0466704_544743 | 3300042643 | Bacteria | 4256 |
| 39 | Ga0466708_167230 | 3300042652 | Bacteria | 4203 |
| 40 | Ga0123353_10113306 | 3300010167 | Bacteria | 4366 |
| 41 | Ga0264413_102393 | 3300024493 | Bacteria | 3323 |
| 42 | Ga0264413_102434 | 3300024493 | Bacteria | 6935 |
| 43 | Ga0264413_104711 | 3300024493 | Bacteria | 6031 |
| 44 | Ga0264413_143281 | 3300024493 | Bacteria | 6386 |
| 45 | Ga0466690_114973 | 3300042590 | Bacteria | 9717 |
| 46 | Ga0466692_043512 | 3300042591 | Bacteria | 12009 |
| 47 | Ga0466691_151131 | 3300042593 | Archaea | 4671 |
| 48 | Ga0466694_103720 | 3300042594 | Unclassified | 17016 |
| 49 | Ga0466694_231182 | 3300042594 | Bacteria | 6356 |
| 50 | Ga0466696_109621 | 3300042596 | Unclassified | 3757 |
| 51 | Ga0466696_389081 | 3300042596 | Bacteria | 8345 |
| 52 | Ga0466716_032507 | 3300042605 | Bacteria | 12790 |
| 53 | Ga0466719_106973 | 3300042606 | Bacteria | 29739 |
| 54 | Ga0466720_100415 | 3300042607 | Bacteria | 36539 |
| 55 | Ga0466698_072184 | 3300042610 | Bacteria | 11052 |
| 56 | Ga0072940_1012669 | 3300005200 | Archaea | 3096 |
| 57 | Ga0466732_364352 | 3300042656 | Bacteria | 25000 |
| 58 | Ga0466712_180228 | 3300042614 | Bacteria | 13858 |
| 59 | Ga0466715_062449 | 3300042616 | Bacteria | 13496 |
| 60 | Ga0466718_139708 | 3300042617 | Bacteria | 35662 |
| 61 | Ga0466726_071493 | 3300042619 | Bacteria | 17665 |
| 62 | Ga0466726_091926 | 3300042619 | Bacteria | 8418 |
| 63 | Ga0466735_090935 | 3300042624 | Bacteria | 12411 |
| 64 | Ga0466704_280972 | 3300042643 | Bacteria | 32550 |
| 65 | Ga0466704_451593 | 3300042643 | Bacteria | 5344 |
| 66 | Ga0466708_052187 | 3300042652 | Bacteria | 5195 |
| 67 | Ga0466708_353797 | 3300042652 | Bacteria | 4333 |
| 68 | Ga0264413_101011 | 3300024493 | Bacteria | 11928 |
| 69 | Ga0466690_005605 | 3300042590 | Bacteria | 4007 |
| 70 | Ga0466692_053844 | 3300042591 | Bacteria | 6655 |
| 71 | Ga0466694_109251 | 3300042594 | Bacteria | 20981 |
| 72 | Ga0466696_263241 | 3300042596 | Bacteria | 32707 |
| 73 | Ga0466716_265661 | 3300042605 | Bacteria | 5239 |
| 74 | Ga0466720_041453 | 3300042607 | Bacteria | 36391 |
| 75 | Ga0466698_490437 | 3300042610 | Unclassified | 3660 |
| 76 | AustNasuHG_c1006222 | 3300000089 | Bacteria | 4266 |
| 77 | Ga0072941_1015854 | 3300005201 | Bacteria | 7744 |
| 78 | Ga0466705_083961 | 3300042612 | Bacteria | 6009 |
| 79 | Ga0466732_440856 | 3300042656 | Bacteria | 3750 |
| 80 | Ga0466712_018398 | 3300042614 | Bacteria | 5486 |
| 81 | Ga0466712_299659 | 3300042614 | Unclassified | 3527 |
| 82 | Ga0466711_223943 | 3300042615 | Bacteria | 11621 |
| 83 | Ga0466715_302518 | 3300042616 | Bacteria | 11190 |
| 84 | Ga0466723_060727 | 3300042618 | Bacteria | 5114 |
| 85 | Ga0466735_060500 | 3300042624 | Bacteria | 10533 |
| 86 | Ga0466704_256660 | 3300042643 | Bacteria | 11035 |
| 87 | Ga0264413_103766 | 3300024493 | Bacteria | 13584 |
| 88 | Ga0466692_013455 | 3300042591 | Bacteria | 3552 |
| 89 | Ga0466691_050697 | 3300042593 | Bacteria | 30471 |
| 90 | Ga0466699_063124 | 3300042597 | Unclassified | 6354 |
| 91 | Ga0466720_029809 | 3300042607 | Bacteria | 15349 |
| 92 | Ga0466720_043999 | 3300042607 | Bacteria | 22878 |
| 93 | AustNasuHG_c1000343 | 3300000089 | Bacteria | 16215 |
| 94 | AustNasuHG_c1002610 | 3300000089 | Bacteria | 6505 |
| 95 | JGI24698J34947_10009631 | 3300002449 | Bacteria | 5294 |
| 96 | JGI24695J34938_10000006 | 3300002450 | Bacteria | 141807 |
| 97 | JGI24695J34938_10002171 | 3300002450 | Bacteria | 15309 |
| 98 | Ga0466705_219569 | 3300042612 | Bacteria | 6727 |
| 99 | Ga0466712_064023 | 3300042614 | Unclassified | 6233 |
| 100 | Ga0466712_136649 | 3300042614 | Bacteria | 51583 |
| 101 | Ga0466715_032839 | 3300042616 | Bacteria | 18047 |
| 102 | Ga0466715_039329 | 3300042616 | Bacteria | 10547 |
| 103 | Ga0466718_025890 | 3300042617 | Bacteria | 19672 |
| 104 | Ga0466726_382729 | 3300042619 | Bacteria | 8857 |
| 105 | Ga0466728_079530 | 3300042620 | Bacteria | 21530 |
| 106 | Ga0466703_168962 | 3300042636 | Bacteria | 3759 |
| 107 | Ga0466704_107068 | 3300042643 | Bacteria | 5127 |
| 108 | Ga0466709_140863 | 3300042648 | Bacteria | 2825 |
| 109 | Ga0264413_112834 | 3300024493 | Bacteria | 8149 |
| 110 | Ga0264413_135160 | 3300024493 | Bacteria | 7658 |
| 111 | Ga0466690_332885 | 3300042590 | Bacteria | 3854 |
| 112 | Ga0466691_109781 | 3300042593 | Bacteria | 6037 |
| 113 | Ga0466694_071384 | 3300042594 | Bacteria | 50432 |
| 114 | Ga0466694_101978 | 3300042594 | Bacteria | 4818 |
| 115 | Ga0466694_125782 | 3300042594 | Bacteria | 25946 |
| 116 | Ga0466696_418445 | 3300042596 | Bacteria | 5957 |
| 117 | Ga0466699_010664 | 3300042597 | Unclassified | 3871 |
| 118 | Ga0466699_047467 | 3300042597 | Bacteria | 11573 |
| 119 | Ga0466699_102883 | 3300042597 | Bacteria | 16516 |
| 120 | Ga0466699_140624 | 3300042597 | Bacteria | 9899 |
| 121 | Ga0466719_104486 | 3300042606 | Bacteria | 8251 |
| 122 | Ga0466720_021975 | 3300042607 | Bacteria | 22180 |
| 123 | Ga0466720_082596 | 3300042607 | Bacteria | 3352 |
| 124 | Ga0466720_211375 | 3300042607 | Bacteria | 60841 |
| 125 | JGI24695J34938_10000111 | 3300002450 | Bacteria | 72830 |
| 126 | Ga0072941_1064018 | 3300005201 | Bacteria | 7231 |
| 127 | Ga0072941_1336403 | 3300005201 | Bacteria | 3379 |
| 128 | Ga0466715_472638 | 3300042616 | Bacteria | 12106 |
| 129 | Ga0466715_489021 | 3300042616 | Bacteria | 34263 |
| 130 | Ga0466726_105473 | 3300042619 | Bacteria | 10066 |
| 131 | Ga0466726_443661 | 3300042619 | Bacteria | 16333 |
| 132 | Ga0466703_326039 | 3300042636 | Bacteria | 10823 |
| 133 | Ga0466704_087888 | 3300042643 | Bacteria | 9187 |
| 134 | Ga0466727_195989 | 3300042655 | Bacteria | 3377 |
| 135 | Ga0264413_116303 | 3300024493 | Bacteria | 5766 |
| 136 | Ga0466690_409375 | 3300042590 | Bacteria | 3064 |
| 137 | Ga0466691_227946 | 3300042593 | Bacteria | 22154 |
| 138 | Ga0466696_143239 | 3300042596 | Bacteria | 7794 |
| 139 | Ga0466699_031858 | 3300042597 | Bacteria | 10513 |
| 140 | Ga0466699_062795 | 3300042597 | Unclassified | 5600 |
| 141 | Ga0466699_118972 | 3300042597 | Bacteria | 29522 |
| 142 | Ga0466716_430140 | 3300042605 | Bacteria | 12454 |
| 143 | Ga0466720_028491 | 3300042607 | Bacteria | 76920 |
| 144 | Ga0466720_034980 | 3300042607 | Bacteria | 11699 |
| 145 | Ga0466722_105400 | 3300042609 | Bacteria | 6519 |
| 146 | Ga0466698_259293 | 3300042610 | Bacteria | 15462 |
| 147 | JGI24698J34947_10008989 | 3300002449 | Bacteria | 5479 |
| 148 | JGI24698J34947_10009200 | 3300002449 | Bacteria | 5421 |
| 149 | JGI24695J34938_10000255 | 3300002450 | Bacteria | 51460 |
| 150 | Ga0072941_1062611 | 3300005201 | Bacteria | 5683 |
| 151 | Ga0466705_286208 | 3300042612 | Bacteria | 3827 |
| 152 | Ga0466712_184515 | 3300042614 | Bacteria | 4391 |
| 153 | Ga0466712_307642 | 3300042614 | Bacteria | 17229 |
| 154 | Ga0466711_497257 | 3300042615 | Bacteria | 16499 |
| 155 | Ga0466715_061752 | 3300042616 | Bacteria | 8516 |
| 156 | Ga0466718_127312 | 3300042617 | Bacteria | 8677 |
| 157 | Ga0466728_204312 | 3300042620 | Bacteria | 4586 |
| 158 | Ga0466704_320679 | 3300042643 | Bacteria | 3971 |
| 159 | Ga0466708_102926 | 3300042652 | Unclassified | 3708 |
| 160 | Ga0466727_248278 | 3300042655 | Bacteria | 6631 |
| 161 | Ga0466727_322649 | 3300042655 | Bacteria | 7501 |
| 162 | Ga0264413_136724 | 3300024493 | Bacteria | 6436 |
| 163 | Ga0466690_282935 | 3300042590 | Bacteria | 3966 |
| 164 | Ga0466692_002215 | 3300042591 | Bacteria | 38338 |
| 165 | Ga0466691_117958 | 3300042593 | Bacteria | 28278 |
| 166 | Ga0466694_342275 | 3300042594 | Bacteria | 17413 |
| 167 | Ga0466699_157175 | 3300042597 | Bacteria | 55178 |
| 168 | Ga0466699_164862 | 3300042597 | Bacteria | 6446 |
| 169 | Ga0466699_311467 | 3300042597 | Bacteria | 10260 |
| 170 | Ga0466707_237783 | 3300042601 | Bacteria | 5452 |
| 171 | Ga0466719_148247 | 3300042606 | Bacteria | 5206 |
| 172 | Ga0466722_214445 | 3300042609 | Bacteria | 10207 |
| 173 | Ga0466698_488468 | 3300042610 | Bacteria | 10780 |
| 174 | JGI24698J34947_10000004 | 3300002449 | Bacteria | 62550 |
| 175 | JGI24698J34947_10000130 | 3300002449 | Bacteria | 27577 |
| 176 | JGI24698J34947_10001459 | 3300002449 | Unclassified | 12451 |
| 177 | Ga0072940_1019011 | 3300005200 | Bacteria | 6401 |
| 178 | Ga0072941_1034143 | 3300005201 | Bacteria | 9043 |
| 179 | Ga0072941_1046581 | 3300005201 | Bacteria | 6641 |
| 180 | Ga0466705_153873 | 3300042612 | Bacteria | 12097 |
| 181 | Ga0466733_161818 | 3300042659 | Bacteria | 5882 |
| 182 | Ga0466712_042724 | 3300042614 | Bacteria | 11388 |
| 183 | Ga0466711_053417 | 3300042615 | Bacteria | 6365 |
| 184 | Ga0466715_114435 | 3300042616 | Bacteria | 19834 |
| 185 | Ga0466715_538135 | 3300042616 | Bacteria | 7932 |
| 186 | Ga0466718_129224 | 3300042617 | Bacteria | 36457 |
| 187 | Ga0466723_108252 | 3300042618 | Bacteria | 3501 |
| 188 | Ga0466735_082530 | 3300042624 | Bacteria | 24525 |
| 189 | Ga0466703_229382 | 3300042636 | Bacteria | 8107 |
| 190 | Ga0466704_100028 | 3300042643 | Unclassified | 4099 |
| 191 | Ga0466708_091420 | 3300042652 | Bacteria | 6041 |
| 192 | Ga0466699_019663 | 3300042597 | Bacteria | 9677 |
| 193 | Ga0466699_422209 | 3300042597 | Bacteria | 15817 |
| 194 | Ga0466713_109771 | 3300042602 | Bacteria | 5581 |
| 195 | Ga0466716_500963 | 3300042605 | Bacteria | 31431 |
| 196 | Ga0466720_029258 | 3300042607 | Bacteria | 50082 |
| 197 | Ga0466720_112435 | 3300042607 | Bacteria | 45324 |
| 198 | JGI24698J34947_10009030 | 3300002449 | Bacteria | 5469 |
| 199 | JGI24702J35022_10012312 | 3300002462 | Bacteria | 4759 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02096 | 60KD_IMP | 60Kd inner membrane protein | 32 | 217 | 0.81 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.