Protein Family IF04698
Metagenome
Isolate
113
Members
37
Samples
110
Scaffolds
244.15
Avg Length
Representative Sequence
- ID
- 3300042591|Ga0466692_149469|Ga0466692_149469_507_1349
- Length
- 280 aa
- Sequence
- LDKSPAVAQRTRQTPPELSVSPAGPLKYRGVKPKQGVFVSSFNDSRTQSGQFKYLDLVMAFFVAVLIVSNIASSAKIVDLGFSLFGIPMSFDGGTLLFPLSYVFGDILTEVYGFKASRRVIWTGFAALALSALVFFVLRLLPPEASWESSTGSAAYDAVLGGMSSGGIVLASLLGYWVGEFSNSVVLSRVKVLMKGRLLWVRTIGSTLVGEFLDSLVFVLAATLAGVFARELFLSLVLTNYLLKCLIEALMTPVTYGAVYALKRGEGVDVYDVGVKYRPV
Sample Types
Isolate
2.6%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
38.9%
Termitidae
33.3%
Unclassified
11.1%
Rhinotermitidae
8.3%
Termopsidae
8.3%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 9 | 2781125639 | Treponema sp. Co191P1bin44 | Isolate | Unclassified |
| 10 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 11 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 12 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 20 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 21 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 22 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 31 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 34 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 35 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 36 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 37 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_043812 | 3300042612 | Bacteria | 6295 |
| 2 | Ga0466705_246180 | 3300042612 | Bacteria | 2524 |
| 3 | Ga0466733_102632 | 3300042659 | Bacteria | 2316 |
| 4 | Ga0466711_166873 | 3300042615 | Bacteria | 10840 |
| 5 | Ga0466726_240266 | 3300042619 | Bacteria | 1195 |
| 6 | Ga0466703_214579 | 3300042636 | Bacteria | 27555 |
| 7 | Ga0466704_218768 | 3300042643 | Bacteria | 93221 |
| 8 | Ga0466708_056510 | 3300042652 | Bacteria | 1563 |
| 9 | JGI24695J34938_10029112 | 3300002450 | Bacteria | 2587 |
| 10 | Ga0466692_149469 | 3300042591 | Bacteria | 2015 |
| 11 | Ga0466691_031150 | 3300042593 | Bacteria | 4662 |
| 12 | Ga0466691_037867 | 3300042593 | Bacteria | 6688 |
| 13 | Ga0466691_049627 | 3300042593 | Bacteria | 5872 |
| 14 | Ga0466696_112055 | 3300042596 | Bacteria | 26359 |
| 15 | Ga0466705_268001 | 3300042612 | Bacteria | 10707 |
| 16 | Ga0466733_164879 | 3300042659 | Bacteria | 1178 |
| 17 | Ga0466723_060220 | 3300042618 | Bacteria | 35228 |
| 18 | Ga0466723_258295 | 3300042618 | Bacteria | 12125 |
| 19 | Ga0466726_086980 | 3300042619 | Bacteria | 2435 |
| 20 | Ga0466726_328787 | 3300042619 | Bacteria | 4056 |
| 21 | Ga0466728_174098 | 3300042620 | Bacteria | 6379 |
| 22 | Ga0466728_199013 | 3300042620 | Bacteria | 7878 |
| 23 | Ga0466728_201238 | 3300042620 | Bacteria | 39281 |
| 24 | Ga0466729_084810 | 3300042621 | Bacteria | 1506 |
| 25 | Ga0466707_150199 | 3300042601 | Bacteria | 1156 |
| 26 | Ga0466716_319345 | 3300042605 | Bacteria | 4756 |
| 27 | Ga0123357_10305318 | 3300009784 | Bacteria | 1599 |
| 28 | Ga0466735_197064 | 3300042624 | Unclassified | 1377 |
| 29 | Ga0466704_317345 | 3300042643 | Bacteria | 2383 |
| 30 | Ga0466727_165238 | 3300042655 | Bacteria | 1380 |
| 31 | Ga0072941_1181013 | 3300005201 | Bacteria | 2128 |
| 32 | Ga0466694_032771 | 3300042594 | Bacteria | 3384 |
| 33 | Ga0466696_095962 | 3300042596 | Bacteria | 3781 |
| 34 | Ga0466699_203219 | 3300042597 | Bacteria | 25669 |
| 35 | Ga0466711_394562 | 3300042615 | Bacteria | 9852 |
| 36 | Ga0466715_091981 | 3300042616 | Bacteria | 4319 |
| 37 | Ga0466726_361624 | 3300042619 | Unclassified | 1444 |
| 38 | Ga0466726_424952 | 3300042619 | Bacteria | 2260 |
| 39 | Ga0466716_068255 | 3300042605 | Bacteria | 6597 |
| 40 | Ga0466719_260500 | 3300042606 | Bacteria | 1352 |
| 41 | Ga0466703_194755 | 3300042636 | Bacteria | 8255 |
| 42 | JGI24695J34938_10000782 | 3300002450 | Bacteria | 29757 |
| 43 | JGI24695J34938_10000866 | 3300002450 | Bacteria | 27990 |
| 44 | Ga0466705_048371 | 3300042612 | Bacteria | 9196 |
| 45 | Ga0466705_271098 | 3300042612 | Bacteria | 1923 |
| 46 | Ga0466723_297263 | 3300042618 | Bacteria | 29498 |
| 47 | Ga0466726_317640 | 3300042619 | Bacteria | 2072 |
| 48 | Ga0466716_315679 | 3300042605 | Bacteria | 28992 |
| 49 | Ga0466720_228994 | 3300042607 | Bacteria | 1311 |
| 50 | Ga0466702_235406 | 3300042635 | Bacteria | 7428 |
| 51 | Ga0466703_188879 | 3300042636 | Bacteria | 76658 |
| 52 | Ga0466703_377194 | 3300042636 | Bacteria | 2824 |
| 53 | Ga0466704_597064 | 3300042643 | Bacteria | 48603 |
| 54 | Ga0466709_070837 | 3300042648 | Bacteria | 7110 |
| 55 | Ga0466708_062401 | 3300042652 | Bacteria | 1984 |
| 56 | Ga0466727_339871 | 3300042655 | Bacteria | 2914 |
| 57 | AustNasuHG_c1006777 | 3300000089 | Bacteria | 4082 |
| 58 | Ga0466690_117011 | 3300042590 | Bacteria | 2052 |
| 59 | Ga0466690_315791 | 3300042590 | Bacteria | 2276 |
| 60 | Ga0466692_043244 | 3300042591 | Bacteria | 8835 |
| 61 | Ga0466696_051711 | 3300042596 | Bacteria | 2118 |
| 62 | Ga0466723_287759 | 3300042618 | Bacteria | 52406 |
| 63 | Ga0466723_335634 | 3300042618 | Bacteria | 5054 |
| 64 | Ga0466726_216472 | 3300042619 | Bacteria | 2477 |
| 65 | Ga0466716_472295 | 3300042605 | Bacteria | 3287 |
| 66 | Ga0466720_040445 | 3300042607 | Unclassified | 3901 |
| 67 | Ga0466722_127353 | 3300042609 | Bacteria | 1020 |
| 68 | Ga0466722_223241 | 3300042609 | Bacteria | 2062 |
| 69 | Ga0466722_258579 | 3300042609 | Bacteria | 5190 |
| 70 | Ga0123356_10117886 | 3300010049 | Bacteria | 2577 |
| 71 | Ga0123354_10201996 | 3300010882 | Bacteria | 2181 |
| 72 | Ga0466735_218130 | 3300042624 | Bacteria | 1173 |
| 73 | Ga0466704_120844 | 3300042643 | Bacteria | 5042 |
| 74 | Ga0466704_341066 | 3300042643 | Bacteria | 16508 |
| 75 | Ga0466727_107887 | 3300042655 | Bacteria | 2961 |
| 76 | Ga0466691_020215 | 3300042593 | Bacteria | 6385 |
| 77 | Ga0466711_316201 | 3300042615 | Bacteria | 1493 |
| 78 | Ga0466717_271218 | 3300042604 | Bacteria | 2046 |
| 79 | Ga0466716_117557 | 3300042605 | Bacteria | 1326 |
| 80 | Ga0466722_017104 | 3300042609 | Bacteria | 6833 |
| 81 | Ga0466722_113786 | 3300042609 | Bacteria | 1857 |
| 82 | Ga0123357_10072589 | 3300009784 | Bacteria | 4560 |
| 83 | Ga0123357_10299965 | 3300009784 | Bacteria | 1625 |
| 84 | Ga0123354_10226087 | 3300010882 | Bacteria | 1971 |
| 85 | Ga0466703_093440 | 3300042636 | Bacteria | 10108 |
| 86 | Ga0466704_378828 | 3300042643 | Unclassified | 9250 |
| 87 | AustNasuHG_c1005477 | 3300000089 | Bacteria | 4536 |
| 88 | Ga0466690_062828 | 3300042590 | Bacteria | 5571 |
| 89 | Ga0466690_109813 | 3300042590 | Unclassified | 5196 |
| 90 | Ga0466690_159574 | 3300042590 | Bacteria | 2792 |
| 91 | Ga0466690_276886 | 3300042590 | Bacteria | 1544 |
| 92 | Ga0466735_037675 | 3300042624 | Bacteria | 1079 |
| 93 | JGI24695J34938_10035451 | 3300002450 | Bacteria | 2281 |
| 94 | Ga0466696_435131 | 3300042596 | Bacteria | 1710 |
| 95 | Ga0466715_186391 | 3300042616 | Bacteria | 6688 |
| 96 | Ga0466723_341872 | 3300042618 | Bacteria | 1546 |
| 97 | Ga0466726_158377 | 3300042619 | Bacteria | 8665 |
| 98 | Ga0466728_427287 | 3300042620 | Bacteria | 3059 |
| 99 | Ga0466722_006884 | 3300042609 | Bacteria | 7730 |
| 100 | Ga0123353_10083521 | 3300010167 | Bacteria | 5139 |
| 101 | Ga0466703_116536 | 3300042636 | Bacteria | 5308 |
| 102 | Ga0466703_414742 | 3300042636 | Bacteria | 1711 |
| 103 | Ga0466708_056463 | 3300042652 | Bacteria | 10539 |
| 104 | Ga0466708_285992 | 3300042652 | Bacteria | 3138 |
| 105 | Ga0466727_094533 | 3300042655 | Bacteria | 1880 |
| 106 | Ga0466727_168843 | 3300042655 | Bacteria | 1809 |
| 107 | Ga0466727_186126 | 3300042655 | Bacteria | 2134 |
| 108 | JGI24695J34938_10002548 | 3300002450 | Bacteria | 13766 |
| 109 | Ga0466691_155741 | 3300042593 | Bacteria | 3767 |
| 110 | Ga0466696_249678 | 3300042596 | Bacteria | 13570 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02592 | Vut_1 | Putative vitamin uptake transporter | 92 | 256 | 0.95 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02592 | GO:1990397 | queuosine salvage | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.