Protein Family IF04541

Metagenome Isolate
103 Members
34 Samples
101 Scaffolds
364.12 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_240299|Ga0466690_240299_2640_3809
Length
389 aa
Sequence
MAPAKTGMEIEKGCFGGCCMIFAVSAKNNVVLRFSKQYSHRLERKFMSTGEWLVYTDNGFIPDNGSITPKPVNGLNFLDADVTEGVYQYRERKFDNPDAKYEISYWVKCGIGDPVGYTFGNYHAPEDEWGEVLTPDDLRGTYCWGTDLRATNGASYTDEQIRFHIIAAMEEMERRLNITIKKTRIVCEPQSRGLKTGIDYDEEESYYTFRRERIQRNGMIMTRKRPVISMSRLDLFNRTEKVFSFLNNSTLDKTKGIVRFFNRPLMPGDTTRAIHNAILPYGADTRNSQLFYAIDYVAGFESSDAVPNDLRAAVGKMCAIELLNIIGDGLMSGFSSSSLSMDGVSXXXXSTQSATSAYYGARIKEYREELDGYIKANRLKFGNVVLGAL

📊 Sample Types

Isolate 1.9%
Metagenome 98.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 40.6%
Termitidae 31.2%
Unclassified 15.6%
Rhinotermitidae 6.2%
Termopsidae 6.2%

🌳 Taxonomy

Archaea 0
Bacteria 91
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
2 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
3 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
4 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
5 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
6 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
7 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
8 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
9 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
10 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
11 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
12 2781125641 Treponema sp. Co191P1bin27 Isolate Unclassified
13 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
16 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
17 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
18 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
19 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
20 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
21 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
22 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
23 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
24 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
25 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
26 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
27 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
28 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
29 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
30 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
34 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_386956 3300042656 Unclassified 30213
2 Ga0466708_340263 3300042652 Bacteria 3545
3 Ga0466712_184754 3300042614 Bacteria 1587
4 Ga0466715_356259 3300042616 Bacteria 11886
5 Ga0466726_394861 3300042619 Bacteria 1736
6 Ga0466705_134656 3300042612 Bacteria 21862
7 Ga0466705_324726 3300042612 Unclassified 5231
8 Ga0466704_051484 3300042643 Unclassified 20188
9 Ga0466704_413170 3300042643 Bacteria 9010
10 Ga0466711_105395 3300042615 Bacteria 12684
11 Ga0466711_161332 3300042615 Unclassified 6115
12 Ga0466711_512770 3300042615 Bacteria 4365
13 Ga0466718_102957 3300042617 Bacteria 10936
14 Ga0466716_107339 3300042605 Bacteria 2850
15 Ga0466719_430545 3300042606 Bacteria 3213
16 Ga0264413_106820 3300024493 Bacteria 5246
17 Ga0466690_090416 3300042590 Bacteria 2787
18 Ga0466690_319135 3300042590 Bacteria 10903
19 Ga0466691_044051 3300042593 Bacteria 3028
20 Ga0466696_115360 3300042596 Bacteria 2129
21 Ga0072940_1052115 3300005200 Bacteria 24937
22 Ga0466705_336598 3300042612 Bacteria 4572
23 Ga0466705_359615 3300042612 Bacteria 5790
24 Ga0466735_027485 3300042624 Bacteria 12181
25 Ga0466708_096541 3300042652 Bacteria 3409
26 Ga0466711_131994 3300042615 Unclassified 3743
27 Ga0466711_458769 3300042615 Bacteria 41673
28 Ga0466718_099381 3300042617 Bacteria 14112
29 Ga0466716_313927 3300042605 Bacteria 5611
30 Ga0466716_329991 3300042605 Bacteria 6899
31 Ga0466690_240299 3300042590 Bacteria 8097
32 Ga0466731_214950 3300042622 Bacteria 3476
33 Ga0466711_301041 3300042615 Bacteria 7213
34 Ga0466715_093299 3300042616 Unclassified 5765
35 Ga0466715_105629 3300042616 Bacteria 2270
36 Ga0466718_014588 3300042617 Bacteria 21339
37 Ga0466723_083333 3300042618 Bacteria 6510
38 Ga0466728_003274 3300042620 Bacteria 15177
39 Ga0466716_200062 3300042605 Bacteria 8238
40 Ga0466716_511751 3300042605 Bacteria 6904
41 Ga0466719_225411 3300042606 Unclassified 10072
42 Ga0466691_022473 3300042593 Bacteria 13663
43 Ga0466699_343043 3300042597 Bacteria 7970
44 JGI24698J34947_10047627 3300002449 Bacteria 2175
45 JGI24700J35501_10930698 3300002508 Unclassified 19203
46 Ga0072941_1142720 3300005201 Bacteria 3629
47 Ga0466705_073276 3300042612 Bacteria 8322
48 Ga0466704_254931 3300042643 Bacteria 23557
49 Ga0466704_461510 3300042643 Bacteria 2528
50 Ga0466708_017792 3300042652 Bacteria 41663
51 Ga0466708_181594 3300042652 Bacteria 9604
52 Ga0466712_116346 3300042614 Bacteria 11322
53 Ga0466715_112879 3300042616 Bacteria 31340
54 Ga0466715_559779 3300042616 Bacteria 1233
55 Ga0466690_008344 3300042590 Bacteria 5234
56 Ga0466690_172381 3300042590 Bacteria 4047
57 Ga0466691_026315 3300042593 Bacteria 28125
58 Ga0466694_248137 3300042594 Bacteria 7142
59 Ga0466696_158569 3300042596 Bacteria 3463
60 Ga0466705_030728 3300042612 Bacteria 7933
61 Ga0466705_048464 3300042612 Bacteria 18191
62 Ga0466705_120178 3300042612 Bacteria 5250
63 Ga0466704_485044 3300042643 Unclassified 18475
64 Ga0466708_114196 3300042652 Bacteria 2195
65 Ga0466711_256780 3300042615 Bacteria 14467
66 Ga0466711_494019 3300042615 Unclassified 2594
67 Ga0466718_078250 3300042617 Bacteria 1632
68 Ga0466726_269993 3300042619 Bacteria 3586
69 Ga0466722_095847 3300042609 Bacteria 7326
70 Ga0264413_149212 3300024493 Bacteria 1308
71 Ga0068305_10003550 3300005083 Bacteria 5872
72 Ga0466705_339673 3300042612 Unclassified 8149
73 Ga0466703_123074 3300042636 Bacteria 48297
74 Ga0466703_148627 3300042636 Bacteria 3165
75 Ga0466718_010118 3300042617 Bacteria 2070
76 Ga0466722_014017 3300042609 Bacteria 4688
77 Ga0466722_184114 3300042609 Bacteria 4854
78 Ga0466722_222398 3300042609 Bacteria 7294
79 Ga0466690_346830 3300042590 Bacteria 4443
80 Ga0466691_041417 3300042593 Bacteria 3491
81 Ga0466694_115948 3300042594 Bacteria 20488
82 Ga0072941_1005022 3300005201 Bacteria 35816
83 Ga0466732_391887 3300042656 Bacteria 19730
84 Ga0466703_396957 3300042636 Bacteria 2526
85 Ga0466704_598514 3300042643 Bacteria 1350
86 Ga0466708_154256 3300042652 Bacteria 12058
87 Ga0466723_177554 3300042618 Bacteria 4598
88 Ga0466726_333624 3300042619 Bacteria 2405
89 Ga0466728_015346 3300042620 Bacteria 2824
90 Ga0466728_079759 3300042620 Bacteria 5485
91 Ga0466728_289594 3300042620 Bacteria 2679
92 Ga0466707_163842 3300042601 Bacteria 2908
93 Ga0466713_101723 3300042602 Bacteria 1735
94 Ga0466716_395075 3300042605 Bacteria 6197
95 Ga0466719_425210 3300042606 Bacteria 6030
96 Ga0466692_049415 3300042591 Bacteria 5384
97 Ga0466691_016928 3300042593 Bacteria 25674
98 Ga0466691_063701 3300042593 Bacteria 1570
99 Ga0466694_050880 3300042594 Bacteria 7592
100 Ga0466696_353686 3300042596 Bacteria 2401
101 JGI24695J34938_10002430 3300002450 Unclassified 14273

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042616 Ga0466715_559779 Ga0466715_559779_15_1004 306
2 3300042617 Ga0466718_078250 Ga0466718_078250_423_1547 316
3 3300042617 Ga0466718_099381 Ga0466718_099381_3184_4308 317
4 3300042615 Ga0466711_494019 Ga0466711_494019_1065_2177 338
5 3300042619 Ga0466726_333624 Ga0466726_333624_941_2050 341
6 3300042656 Ga0466732_386956 Ga0466732_386956_21686_22810 342
7 3300042615 Ga0466711_301041 Ga0466711_301041_2590_3708 344
8 3300042615 Ga0466711_105395 Ga0466711_105395_5196_6308 345
9 3300042616 Ga0466715_105629 Ga0466715_105629_986_2125 346
10 3300042636 Ga0466703_396957 Ga0466703_396957_473_1624 349
11 3300002450 JGI24695J34938_10002430 JGI24695J34938_1000243010 351
12 3300042605 Ga0466716_329991 Ga0466716_329991_2791_3906 351
13 3300042596 Ga0466696_353686 Ga0466696_353686_41_1174 353
14 3300042652 Ga0466708_181594 Ga0466708_181594_684_1787 354
15 3300042605 Ga0466716_395075 Ga0466716_395075_545_1651 356
16 3300042619 Ga0466726_269993 Ga0466726_269993_1440_2513 357
17 3300042596 Ga0466696_158569 Ga0466696_158569_1941_3056 358
18 3300042606 Ga0466719_225411 Ga0466719_225411_3853_4968 358
19 3300042612 Ga0466705_048464 Ga0466705_048464_6033_7148 358
20 3300042612 Ga0466705_073276 Ga0466705_073276_6816_7931 358
21 3300042612 Ga0466705_359615 Ga0466705_359615_1243_2358 358
22 3300042643 Ga0466704_413170 Ga0466704_413170_4746_5861 358
23 3300042643 Ga0466704_598514 Ga0466704_598514_65_1180 358
24 3300002508 JGI24700J35501_10930698 JGI24700J35501_1093069810 359
25 3300042591 Ga0466692_049415 Ga0466692_049415_1774_2886 359
26 3300042601 Ga0466707_163842 Ga0466707_163842_1374_2507 359
27 3300042620 Ga0466728_079759 Ga0466728_079759_2363_3493 359
28 3300042624 Ga0466735_027485 Ga0466735_027485_4385_5497 359
29 3300042614 Ga0466712_184754 Ga0466712_184754_444_1574 360
30 3300042590 Ga0466690_319135 Ga0466690_319135_3806_4918 361
31 3300042593 Ga0466691_016928 Ga0466691_016928_1065_2177 361
32 3300042615 Ga0466711_458769 Ga0466711_458769_16639_17757 361
33 3300042618 Ga0466723_083333 Ga0466723_083333_1279_2391 361
34 3300005200 Ga0072940_1052115 Ga0072940_10521155 362
35 3300042609 Ga0466722_222398 Ga0466722_222398_5731_6846 362
36 3300042617 Ga0466718_010118 Ga0466718_010118_380_1495 362
37 3300042590 Ga0466690_172381 Ga0466690_172381_107_1231 363
38 3300042615 Ga0466711_161332 Ga0466711_161332_73_1182 363
39 3300042590 Ga0466690_008344 Ga0466690_008344_3164_4285 364
40 3300042593 Ga0466691_026315 Ga0466691_026315_20182_21306 364
41 3300042594 Ga0466694_050880 Ga0466694_050880_268_1395 364
42 3300042620 Ga0466728_003274 Ga0466728_003274_11369_12496 364
43 3300002449 JGI24698J34947_10047627 JGI24698J34947_100476271 365
44 3300042605 Ga0466716_313927 Ga0466716_313927_22_1146 365
45 3300042652 Ga0466708_340263 Ga0466708_340263_1774_2898 365
46 3300024493 Ga0264413_149212 Ga0264413_1492121 366
47 3300042605 Ga0466716_511751 Ga0466716_511751_4402_5517 366
48 3300042615 Ga0466711_131994 Ga0466711_131994_1784_2899 366
49 3300042616 Ga0466715_093299 Ga0466715_093299_3395_4510 366
50 3300042593 Ga0466691_041417 Ga0466691_041417_2062_3195 367
51 3300042594 Ga0466694_115948 Ga0466694_115948_14385_15515 367
52 3300042609 Ga0466722_184114 Ga0466722_184114_235_1365 367
53 3300042612 Ga0466705_134656 Ga0466705_134656_14038_15165 367
54 iso_pr_bacteria 2819994798 2819997115 367
55 3300042652 Ga0466708_096541 Ga0466708_096541_1106_2239 368
56 3300005083 Ga0068305_10003550 Ga0068305_100035504 369
57 3300042590 Ga0466690_346830 Ga0466690_346830_1574_2710 369
58 3300042615 Ga0466711_256780 Ga0466711_256780_8680_9789 369
59 3300042615 Ga0466711_512770 Ga0466711_512770_73_1182 369
60 3300042620 Ga0466728_289594 Ga0466728_289594_1021_2130 369
61 3300042636 Ga0466703_148627 Ga0466703_148627_1671_2780 369
62 3300042590 Ga0466690_090416 Ga0466690_090416_300_1412 370
63 3300042593 Ga0466691_044051 Ga0466691_044051_1778_2890 370
64 3300042605 Ga0466716_107339 Ga0466716_107339_1170_2282 370
65 3300042606 Ga0466719_430545 Ga0466719_430545_1142_2254 370
66 3300042609 Ga0466722_014017 Ga0466722_014017_1703_2815 370
67 3300042609 Ga0466722_095847 Ga0466722_095847_2198_3310 370
68 3300042612 Ga0466705_030728 Ga0466705_030728_5529_6659 370
69 3300042612 Ga0466705_339673 Ga0466705_339673_5960_7072 370
70 3300042643 Ga0466704_254931 Ga0466704_254931_15555_16667 370
71 3300042643 Ga0466704_461510 Ga0466704_461510_10_1140 370
72 3300042652 Ga0466708_017792 Ga0466708_017792_26596_27735 370
73 3300042652 Ga0466708_114196 Ga0466708_114196_259_1371 370
74 3300042652 Ga0466708_154256 Ga0466708_154256_162_1274 370
75 3300042612 Ga0466705_324726 Ga0466705_324726_2429_3544 371
76 3300042616 Ga0466715_112879 Ga0466715_112879_7932_9047 371
77 3300042618 Ga0466723_177554 Ga0466723_177554_3401_4516 371
78 3300042643 Ga0466704_485044 Ga0466704_485044_1632_2747 371
79 3300005201 Ga0072941_1005022 Ga0072941_100502226 372
80 3300042593 Ga0466691_063701 Ga0466691_063701_239_1357 372
81 3300042606 Ga0466719_425210 Ga0466719_425210_325_1443 372
82 3300042617 Ga0466718_014588 Ga0466718_014588_11224_12345 373
83 3300042656 Ga0466732_391887 Ga0466732_391887_5883_7004 373
84 3300024493 Ga0264413_106820 Ga0264413_1068202 374
85 3300042593 Ga0466691_022473 Ga0466691_022473_2105_3229 374
86 3300042605 Ga0466716_200062 Ga0466716_200062_829_1953 374
87 3300042612 Ga0466705_120178 Ga0466705_120178_954_2078 374
88 3300042620 Ga0466728_015346 Ga0466728_015346_1538_2662 374
89 3300042643 Ga0466704_051484 Ga0466704_051484_17643_18767 374
90 3300005201 Ga0072941_1142720 Ga0072941_11427204 375
91 3300042594 Ga0466694_248137 Ga0466694_248137_4380_5507 375
92 3300042596 Ga0466696_115360 Ga0466696_115360_135_1262 375
93 3300042612 Ga0466705_336598 Ga0466705_336598_229_1356 375
94 3300042614 Ga0466712_116346 Ga0466712_116346_2093_3220 375
95 3300042636 Ga0466703_123074 Ga0466703_123074_14882_16009 375
96 3300042597 Ga0466699_343043 Ga0466699_343043_178_1308 376
97 3300042622 Ga0466731_214950 Ga0466731_214950_1955_3085 376
98 3300042602 Ga0466713_101723 Ga0466713_101723_230_1363 377
99 3300042619 Ga0466726_394861 Ga0466726_394861_230_1363 377
100 3300042617 Ga0466718_102957 Ga0466718_102957_945_2081 378
101 iso_pr_bacteria 2781125641 2781289802 378
102 3300042616 Ga0466715_356259 Ga0466715_356259_3795_4961 388
103 3300042590 Ga0466690_240299 Ga0466690_240299_2640_3809 389

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.7 0.73 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.