Protein Family IF04503

Metagenome Isolate
138 Members
40 Samples
128 Scaffolds
240.39 Avg Length

🧬 Representative Sequence

ID
3300042590|Ga0466690_139050|Ga0466690_139050_839_1585
Length
248 aa
Sequence
MDLGGQLMASLDIKTVFSITVAGRTIPVTESVVVSWAVMALLIAGALVLTRNLQRIPKGAQTLLEAGIEFLNGFSKQQFGSRAKIFGPYIGTVFLFLLAANVLPAITPVYALGIPPAFDIKPPTRDINVCAALAVITVTLMLLSGLIARGPAGWGRKLLQPVPLMLPFNLLEYVIRPLSLCLRLFGNMLGGFIIMSLISIALAGAIKFSVIIPLPFSLYFDFFDGFVQALVFTFLTTLYVSEAVNTAE

📊 Sample Types

Isolate 7.2%
Metagenome 92.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 57.9%
Unclassified 26.3%
Kalotermitidae 7.9%
Termopsidae 5.3%
Rhinotermitidae 2.6%

🌳 Taxonomy

Archaea 1
Bacteria 131
Eukaryota 0
Viruses 0
Unclassified 6

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
2 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
3 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
4 2781125688 Treponema sp. Lab288P4bin13 Isolate Unclassified
5 2781125691 Treponema sp. Th196P3bin73 Isolate Unclassified
6 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
7 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
8 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
9 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
10 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
11 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
12 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
13 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 650716102 Treponema primitia ZAS-2 Isolate Unclassified
17 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
18 2781125666 Treponema sp. Emb289P4bin7 Isolate Unclassified
19 2819992462 Unclassified Spirochaetes Nc150P4bin14 Isolate Unclassified
20 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
21 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
22 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
23 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
24 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
25 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
26 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
27 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
28 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
29 2781125686 Treponema sp. Lab288P4bin22 Isolate Unclassified
30 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
31 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
32 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
33 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
34 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
35 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
36 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
37 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
38 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
39 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
40 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_087360 3300042656 Bacteria 1522
2 Ga0466732_107649 3300042656 Bacteria 2242
3 Ga0466712_101071 3300042614 Bacteria 19503
4 Ga0466712_196166 3300042614 Bacteria 10205
5 Ga0466718_111941 3300042617 Unclassified 1721
6 Ga0466726_012968 3300042619 Bacteria 2059
7 Ga0466707_301246 3300042601 Bacteria 2983
8 Ga0466720_115859 3300042607 Bacteria 11372
9 Ga0466731_213672 3300042622 Bacteria 3744
10 JGI24698J34947_10002354 3300002449 Bacteria 10172
11 JGI24698J34947_10025149 3300002449 Bacteria 3170
12 JGI24698J34947_10111597 3300002449 Bacteria 1206
13 JGI24698J34947_10149983 3300002449 Bacteria 969
14 JGI24702J35022_10027188 3300002462 Unclassified 3078
15 JGI24699J35502_11126624 3300002509 Bacteria 3995
16 Ga0264413_107518 3300024493 Bacteria 40797
17 Ga0466690_139050 3300042590 Bacteria 2695
18 Ga0466692_051610 3300042591 Bacteria 6399
19 Ga0466692_069537 3300042591 Bacteria 8989
20 Ga0466694_319436 3300042594 Bacteria 51857
21 Ga0466699_122625 3300042597 Bacteria 28030
22 Ga0466699_276943 3300042597 Bacteria 1170
23 Ga0466699_371730 3300042597 Bacteria 1228
24 Ga0466712_029559 3300042614 Bacteria 21198
25 Ga0466712_126441 3300042614 Bacteria 83990
26 Ga0466712_158367 3300042614 Unclassified 9867
27 Ga0123354_10051406 3300010882 Bacteria 6224
28 Ga0466700_220785 3300042600 Bacteria 1553
29 Ga0466735_110813 3300042624 Bacteria 5040
30 Ga0466735_225271 3300042624 Bacteria 16419
31 AustNasuHG_c1000763 3300000089 Bacteria 11473
32 JGI24698J34947_10002496 3300002449 Bacteria 9930
33 JGI24698J34947_10015817 3300002449 Bacteria 4103
34 JGI24698J34947_10051934 3300002449 Bacteria 2059
35 JGI24698J34947_10080284 3300002449 Bacteria 1533
36 Ga0123357_10000489 3300009784 Bacteria 38470
37 Ga0264413_101010 3300024493 Bacteria 8837
38 Ga0466692_161009 3300042591 Bacteria 1200
39 Ga0466695_095640 3300042595 Bacteria 6690
40 Ga0466699_014341 3300042597 Bacteria 2414
41 Ga0466699_105364 3300042597 Bacteria 4552
42 Ga0466699_332441 3300042597 Bacteria 1172
43 Ga0466712_032417 3300042614 Bacteria 10721
44 Ga0466712_060436 3300042614 Bacteria 1075
45 Ga0466712_072573 3300042614 Bacteria 2435
46 Ga0466712_093476 3300042614 Bacteria 14863
47 Ga0466712_124444 3300042614 Bacteria 16631
48 Ga0466712_165211 3300042614 Bacteria 10653
49 Ga0466718_042183 3300042617 Bacteria 62729
50 Ga0123353_10312030 3300010167 Bacteria 2392
51 Ga0466720_110596 3300042607 Bacteria 36874
52 Ga0466720_172738 3300042607 Unclassified 2568
53 JGI24698J34947_10001921 3300002449 Bacteria 11065
54 JGI24698J34947_10019125 3300002449 Bacteria 3698
55 JGI24698J34947_10019223 3300002449 Bacteria 3689
56 JGI24695J34938_10000943 3300002450 Bacteria 26509
57 JGI24695J34938_10003966 3300002450 Bacteria 9973
58 Ga0264413_125704 3300024493 Bacteria 2924
59 Ga0466692_023750 3300042591 Bacteria 2709
60 Ga0466699_235961 3300042597 Bacteria 1447
61 Ga0466699_237072 3300042597 Bacteria 1782
62 Ga0466699_337441 3300042597 Bacteria 2104
63 Ga0466712_177651 3300042614 Bacteria 1205
64 Ga0466712_248752 3300042614 Bacteria 4553
65 Ga0466711_246244 3300042615 Bacteria 1980
66 Ga0123356_10177577 3300010049 Bacteria 2148
67 Ga0123353_10213867 3300010167 Bacteria 3021
68 Ga0466700_312034 3300042600 Bacteria 5174
69 Ga0466707_394262 3300042601 Bacteria 2476
70 Ga0466720_001629 3300042607 Bacteria 2108
71 Ga0466698_174051 3300042610 Bacteria 7167
72 Ga0466692_139359 3300042591 Bacteria 2008
73 Ga0466732_211494 3300042656 Bacteria 1361
74 Ga0466718_032515 3300042617 Bacteria 12885
75 Ga0466720_059875 3300042607 Bacteria 16278
76 Ga0466731_021420 3300042622 Archaea 2885
77 Ga0466735_181108 3300042624 Bacteria 1428
78 Ga0466702_041665 3300042635 Bacteria 1604
79 AustNasuHG_c1014985 3300000089 Bacteria 2624
80 JGI24698J34947_10004811 3300002449 Bacteria 7385
81 Ga0466657_150012 3300042582 Bacteria 2222
82 Ga0466693_104807 3300042592 Bacteria 1161
83 Ga0466694_042337 3300042594 Bacteria 1414
84 Ga0466699_072543 3300042597 Bacteria 9594
85 Ga0466699_340055 3300042597 Bacteria 3375
86 Ga0466712_169423 3300042614 Bacteria 10051
87 Ga0466712_216396 3300042614 Bacteria 3351
88 Ga0466712_307983 3300042614 Bacteria 4478
89 Ga0466718_053607 3300042617 Bacteria 11812
90 Ga0466718_111195 3300042617 Bacteria 1681
91 Ga0123353_10184558 3300010167 Bacteria 3299
92 Ga0123353_10671091 3300010167 Bacteria 1462
93 Ga0466700_054393 3300042600 Bacteria 1522
94 Ga0466720_081367 3300042607 Bacteria 5473
95 Ga0466720_233881 3300042607 Bacteria 13856
96 Ga0466731_138289 3300042622 Bacteria 9701
97 Ga0466735_141381 3300042624 Bacteria 1666
98 JGI24698J34947_10017981 3300002449 Bacteria 3826
99 Ga0466692_133550 3300042591 Bacteria 1130
100 Ga0466699_247080 3300042597 Bacteria 1672
101 Ga0466699_280968 3300042597 Bacteria 14109
102 Ga0466712_210370 3300042614 Bacteria 7978
103 Ga0466718_003703 3300042617 Bacteria 8470
104 Ga0466718_138075 3300042617 Bacteria 14483
105 Ga0123357_10307320 3300009784 Bacteria 1590
106 Ga0466720_027618 3300042607 Bacteria 12153
107 Ga0466720_080482 3300042607 Bacteria 7353
108 Ga0466720_156710 3300042607 Unclassified 3254
109 Ga0466698_266378 3300042610 Bacteria 2602
110 Ga0466731_205752 3300042622 Bacteria 1718
111 JGI24699J35502_11047273 3300002509 Bacteria 1622
112 Ga0466692_011527 3300042591 Bacteria 18142
113 Ga0466699_064800 3300042597 Bacteria 4798
114 Ga0466718_077171 3300042617 Bacteria 4946
115 Ga0123354_10082559 3300010882 Bacteria 4529
116 Ga0466700_137809 3300042600 Bacteria 1143
117 Ga0466700_320773 3300042600 Bacteria 3171
118 Ga0466731_059023 3300042622 Bacteria 2102
119 Ga0466702_045729 3300042635 Bacteria 1485
120 Ga0466702_314590 3300042635 Bacteria 1008
121 JGI24698J34947_10010269 3300002449 Bacteria 5134
122 JGI24698J34947_10053577 3300002449 Bacteria 2018
123 JGI24698J34947_10147845 3300002449 Unclassified 980
124 Ga0072941_1003951 3300005201 Bacteria 12993
125 Ga0264413_108293 3300024493 Bacteria 4214
126 Ga0466696_059536 3300042596 Bacteria 2084
127 Ga0466699_013348 3300042597 Bacteria 2132
128 Ga0466699_041707 3300042597 Bacteria 2480

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00119 ATP-synt_A ATP synthase A chain 33 241 0.88

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.