Protein Family IF04323
Metagenome
Isolate
115
Members
38
Samples
110
Scaffolds
310.98
Avg Length
Representative Sequence
- ID
- 3300038395|Ga0415639_109370|Ga0415639_109370_1619_2635
- Length
- 338 aa
- Sequence
- MSIRKIAAKMAENWPAKVLSIGLAIIIFVFHRMSTQEERFFSVPLSIDRSGPLVPAASYPRMIRVNLRGEPASVFSIMENDIEVYIDMNRLEQPGVYTVPVQWRKRNTIQGGEPVQITVDPMEITLSLDHRITRTVPVTADLRGQIDTGHTMTWHSLNPAQVVIEGPAALISGVPEIFTEVINLAGRRNDFSQVAAILNPDPLVIILGSGTTEFRGSVAQIIPVRNIANVPIAITGLMEGLAGELEIAAASLRLEGGSQAALDAFVPGADFLQVDASGIEQPGTYILRVLAASADNVSITVDLEEVILYISLSDIADPRYPGDLTGLDDIIYDEDEAL
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
37.8%
Termitidae
32.4%
Unclassified
16.2%
Termopsidae
8.1%
Rhinotermitidae
5.4%
Taxonomy
Archaea
0
Bacteria
114
Eukaryota
0
Viruses
0
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 2 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 5 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 6 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 7 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 8 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 9 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 10 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 11 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 12 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 13 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 14 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 17 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 18 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 19 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 20 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 21 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 22 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 23 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 24 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 25 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 26 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 33 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 34 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466704_307357 | 3300042643 | Bacteria | 6010 |
| 2 | Ga0466727_070464 | 3300042655 | Bacteria | 4051 |
| 3 | Ga0466694_056566 | 3300042594 | Bacteria | 4033 |
| 4 | Ga0466715_243549 | 3300042616 | Bacteria | 13882 |
| 5 | Ga0466715_548575 | 3300042616 | Bacteria | 6310 |
| 6 | Ga0466707_233608 | 3300042601 | Bacteria | 1100 |
| 7 | Ga0466720_057406 | 3300042607 | Bacteria | 28295 |
| 8 | Ga0466705_356905 | 3300042612 | Bacteria | 29178 |
| 9 | Ga0466704_046384 | 3300042643 | Bacteria | 22946 |
| 10 | Ga0466708_080579 | 3300042652 | Bacteria | 4877 |
| 11 | Ga0415639_257311 | 3300038395 | Bacteria | 1364 |
| 12 | Ga0466712_085801 | 3300042614 | Bacteria | 23112 |
| 13 | Ga0466711_306255 | 3300042615 | Bacteria | 1926 |
| 14 | Ga0466715_000572 | 3300042616 | Bacteria | 21083 |
| 15 | Ga0466716_159325 | 3300042605 | Bacteria | 11511 |
| 16 | Ga0466719_104809 | 3300042606 | Bacteria | 3464 |
| 17 | Ga0466719_389225 | 3300042606 | Bacteria | 11545 |
| 18 | Ga0466733_104487 | 3300042659 | Bacteria | 1383 |
| 19 | Ga0466703_019965 | 3300042636 | Bacteria | 1964 |
| 20 | Ga0466703_301914 | 3300042636 | Bacteria | 1249 |
| 21 | Ga0466703_393169 | 3300042636 | Bacteria | 3785 |
| 22 | Ga0466704_347511 | 3300042643 | Bacteria | 15892 |
| 23 | Ga0466691_049619 | 3300042593 | Bacteria | 15579 |
| 24 | Ga0466694_059553 | 3300042594 | Unclassified | 2704 |
| 25 | Ga0466694_400844 | 3300042594 | Bacteria | 2343 |
| 26 | Ga0466712_076648 | 3300042614 | Bacteria | 31023 |
| 27 | Ga0466712_172819 | 3300042614 | Bacteria | 12746 |
| 28 | Ga0466711_011465 | 3300042615 | Bacteria | 7895 |
| 29 | Ga0466718_033853 | 3300042617 | Bacteria | 13524 |
| 30 | Ga0466723_133933 | 3300042618 | Bacteria | 2735 |
| 31 | Ga0466726_243314 | 3300042619 | Bacteria | 1112 |
| 32 | Ga0466726_291647 | 3300042619 | Bacteria | 1235 |
| 33 | Ga0466716_345161 | 3300042605 | Bacteria | 3465 |
| 34 | JGI24698J34947_10001891 | 3300002449 | Bacteria | 11161 |
| 35 | Ga0466705_136352 | 3300042612 | Bacteria | 10984 |
| 36 | Ga0466729_209216 | 3300042621 | Bacteria | 1865 |
| 37 | Ga0466735_101552 | 3300042624 | Bacteria | 3340 |
| 38 | Ga0466727_175526 | 3300042655 | Bacteria | 7298 |
| 39 | Ga0123353_10248130 | 3300010167 | Bacteria | 2760 |
| 40 | Ga0466712_069198 | 3300042614 | Bacteria | 2747 |
| 41 | Ga0466715_250478 | 3300042616 | Bacteria | 13481 |
| 42 | Ga0466723_356718 | 3300042618 | Bacteria | 8341 |
| 43 | Ga0466728_175439 | 3300042620 | Bacteria | 13012 |
| 44 | Ga0466728_320606 | 3300042620 | Bacteria | 11540 |
| 45 | Ga0466700_418203 | 3300042600 | Bacteria | 1621 |
| 46 | Ga0466707_401173 | 3300042601 | Bacteria | 2058 |
| 47 | Ga0466720_035328 | 3300042607 | Bacteria | 9131 |
| 48 | Ga0466722_248094 | 3300042609 | Bacteria | 4921 |
| 49 | AustNasuHG_c1011781 | 3300000089 | Bacteria | 3028 |
| 50 | Ga0466705_146183 | 3300042612 | Bacteria | 7473 |
| 51 | Ga0466703_020316 | 3300042636 | Bacteria | 1175 |
| 52 | Ga0415639_109370 | 3300038395 | Bacteria | 2692 |
| 53 | Ga0466694_250394 | 3300042594 | Bacteria | 6992 |
| 54 | Ga0466695_318570 | 3300042595 | Bacteria | 4252 |
| 55 | Ga0123353_10025059 | 3300010167 | Bacteria | 9077 |
| 56 | Ga0123353_10366470 | 3300010167 | Bacteria | 2162 |
| 57 | Ga0123353_10615179 | 3300010167 | Bacteria | 1548 |
| 58 | Ga0466715_137352 | 3300042616 | Bacteria | 2568 |
| 59 | Ga0466715_239229 | 3300042616 | Bacteria | 14401 |
| 60 | Ga0466715_456991 | 3300042616 | Bacteria | 2685 |
| 61 | Ga0466718_084149 | 3300042617 | Bacteria | 9125 |
| 62 | Ga0466723_206226 | 3300042618 | Bacteria | 4965 |
| 63 | Ga0466726_213065 | 3300042619 | Bacteria | 3258 |
| 64 | Ga0466726_457625 | 3300042619 | Bacteria | 3773 |
| 65 | Ga0466719_252781 | 3300042606 | Bacteria | 5713 |
| 66 | Ga0466719_517032 | 3300042606 | Bacteria | 2211 |
| 67 | JGI24698J34947_10011556 | 3300002449 | Bacteria | 4846 |
| 68 | Ga0466703_254861 | 3300042636 | Bacteria | 6146 |
| 69 | Ga0466727_206613 | 3300042655 | Bacteria | 1562 |
| 70 | Ga0466727_259375 | 3300042655 | Bacteria | 4866 |
| 71 | Ga0466690_307247 | 3300042590 | Bacteria | 1611 |
| 72 | Ga0466691_187278 | 3300042593 | Bacteria | 9907 |
| 73 | Ga0123353_10243458 | 3300010167 | Bacteria | 2792 |
| 74 | Ga0123353_10430498 | 3300010167 | Bacteria | 1951 |
| 75 | Ga0466705_407181 | 3300042612 | Bacteria | 4904 |
| 76 | Ga0466715_623529 | 3300042616 | Bacteria | 9125 |
| 77 | Ga0466726_049611 | 3300042619 | Bacteria | 21342 |
| 78 | Ga0466703_058685 | 3300042636 | Bacteria | 36786 |
| 79 | Ga0466704_166632 | 3300042643 | Bacteria | 9299 |
| 80 | Ga0466708_184464 | 3300042652 | Bacteria | 3881 |
| 81 | Ga0466708_334123 | 3300042652 | Bacteria | 55617 |
| 82 | Ga0466727_017069 | 3300042655 | Bacteria | 2248 |
| 83 | Ga0466727_253152 | 3300042655 | Bacteria | 2475 |
| 84 | Ga0415639_232556 | 3300038395 | Bacteria | 1673 |
| 85 | Ga0466696_349334 | 3300042596 | Bacteria | 1387 |
| 86 | Ga0466711_081013 | 3300042615 | Bacteria | 10213 |
| 87 | Ga0466715_549137 | 3300042616 | Bacteria | 3704 |
| 88 | Ga0466723_033385 | 3300042618 | Bacteria | 15758 |
| 89 | Ga0466723_052167 | 3300042618 | Bacteria | 6533 |
| 90 | Ga0466720_111891 | 3300042607 | Bacteria | 23574 |
| 91 | JGI24698J34947_10000878 | 3300002449 | Bacteria | 15193 |
| 92 | JGI24698J34947_10001064 | 3300002449 | Bacteria | 14129 |
| 93 | JGI24698J34947_10017876 | 3300002449 | Bacteria | 3839 |
| 94 | Ga0072941_1059492 | 3300005201 | Bacteria | 18068 |
| 95 | Ga0466703_069449 | 3300042636 | Bacteria | 19224 |
| 96 | Ga0466709_355067 | 3300042648 | Bacteria | 1272 |
| 97 | Ga0466709_384223 | 3300042648 | Bacteria | 15086 |
| 98 | Ga0466727_343802 | 3300042655 | Bacteria | 1509 |
| 99 | Ga0415639_094728 | 3300038395 | Bacteria | 3948 |
| 100 | Ga0415639_113158 | 3300038395 | Bacteria | 6369 |
| 101 | Ga0123353_10271024 | 3300010167 | Bacteria | 2615 |
| 102 | Ga0123353_10560919 | 3300010167 | Bacteria | 1644 |
| 103 | Ga0466705_437384 | 3300042612 | Bacteria | 18300 |
| 104 | Ga0466712_012501 | 3300042614 | Bacteria | 1937 |
| 105 | Ga0466726_152828 | 3300042619 | Bacteria | 3292 |
| 106 | Ga0466726_246112 | 3300042619 | Bacteria | 1842 |
| 107 | Ga0466719_403668 | 3300042606 | Bacteria | 8615 |
| 108 | Ga0466720_031040 | 3300042607 | Bacteria | 19260 |
| 109 | JGI24698J34947_10003882 | 3300002449 | Bacteria | 8130 |
| 110 | Ga0072940_1022560 | 3300005200 | Bacteria | 8087 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF07949 | YbbR | YbbR-like protein | 136 | 206 | 0.94 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.