Protein Family IF04184
Metagenome
Isolate
175
Members
46
Samples
171
Scaffolds
259.19
Avg Length
Representative Sequence
- ID
- 3300024493|Ga0264413_130461|Ga0264413_1304612
- Length
- 255 aa
- Sequence
- MKKLTLTALFLTAVLALHAQEADSIVRSSRDRIKADTVSTRARMVIYAKDSSTSERLVDQYSKDGPNGSRAVIVFQQPASVTGTRFLTMQNAGGEDRWIFLPSLGKVRRIAASEGSGSFMGTDFSYDDVSSASRSVDLDTHTMLREENYSNAACYVIQSVPKNSSYQYSKMVQWIQKDSLITAKIELYDKRNTLVKTAEMSGIKDIQGRLTATVTKMTTHAAGTYTIITNEITKYNDPIPESVFTVEYLETGRPR
Sample Types
Isolate
2.3%
Metagenome
97.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.5%
Kalotermitidae
31.8%
Unclassified
11.4%
Termopsidae
6.8%
Rhinotermitidae
4.5%
Taxonomy
Archaea
1
Bacteria
155
Eukaryota
0
Viruses
0
Unclassified
19
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 3 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 6 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 7 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 8 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 9 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 10 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 11 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 12 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 13 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 24 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 25 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 29 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 32 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 33 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 34 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 35 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 36 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 37 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 38 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 40 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 41 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_029693 | 3300042612 | Bacteria | 3275 |
| 2 | Ga0466705_332090 | 3300042612 | Bacteria | 23948 |
| 3 | Ga0466732_020001 | 3300042656 | Bacteria | 2367 |
| 4 | Ga0264413_104168 | 3300024493 | Bacteria | 6702 |
| 5 | Ga0466691_116881 | 3300042593 | Bacteria | 8416 |
| 6 | Ga0466711_180338 | 3300042615 | Bacteria | 18953 |
| 7 | Ga0466715_373572 | 3300042616 | Bacteria | 2603 |
| 8 | Ga0466715_373815 | 3300042616 | Bacteria | 7242 |
| 9 | Ga0466707_137731 | 3300042601 | Bacteria | 10166 |
| 10 | Ga0466717_243039 | 3300042604 | Bacteria | 1404 |
| 11 | Ga0466719_013218 | 3300042606 | Bacteria | 5558 |
| 12 | Ga0466719_415036 | 3300042606 | Unclassified | 1274 |
| 13 | Ga0466720_077188 | 3300042607 | Bacteria | 22361 |
| 14 | Ga0466720_080512 | 3300042607 | Bacteria | 26691 |
| 15 | JGI24698J34947_10003214 | 3300002449 | Bacteria | 8856 |
| 16 | Ga0466731_396118 | 3300042622 | Bacteria | 2156 |
| 17 | Ga0466702_174764 | 3300042635 | Bacteria | 1307 |
| 18 | Ga0466703_214588 | 3300042636 | Bacteria | 13776 |
| 19 | Ga0466709_015476 | 3300042648 | Bacteria | 5728 |
| 20 | Ga0466709_134624 | 3300042648 | Bacteria | 13149 |
| 21 | Ga0466690_200192 | 3300042590 | Bacteria | 5084 |
| 22 | Ga0466692_079528 | 3300042591 | Bacteria | 29510 |
| 23 | Ga0466691_102862 | 3300042593 | Unclassified | 12096 |
| 24 | Ga0466694_386892 | 3300042594 | Bacteria | 1547 |
| 25 | Ga0466696_320697 | 3300042596 | Bacteria | 5879 |
| 26 | Ga0466718_121149 | 3300042617 | Bacteria | 1363 |
| 27 | Ga0466723_047736 | 3300042618 | Bacteria | 12328 |
| 28 | Ga0466723_053478 | 3300042618 | Bacteria | 7378 |
| 29 | 2230969639 | 2228664004 | Bacteria | 7558 |
| 30 | JGI24695J34938_10088508 | 3300002450 | Bacteria | 1272 |
| 31 | Ga0466703_076459 | 3300042636 | Unclassified | 4729 |
| 32 | Ga0466692_055697 | 3300042591 | Bacteria | 29527 |
| 33 | Ga0466691_035489 | 3300042593 | Bacteria | 18589 |
| 34 | Ga0466691_097917 | 3300042593 | Bacteria | 7496 |
| 35 | Ga0466696_178520 | 3300042596 | Bacteria | 1404 |
| 36 | Ga0466712_033331 | 3300042614 | Unclassified | 2648 |
| 37 | Ga0466711_263338 | 3300042615 | Bacteria | 27803 |
| 38 | Ga0466718_028236 | 3300042617 | Bacteria | 32464 |
| 39 | Ga0466718_072574 | 3300042617 | Bacteria | 6194 |
| 40 | Ga0466718_170420 | 3300042617 | Bacteria | 1063 |
| 41 | Ga0466723_162893 | 3300042618 | Bacteria | 8583 |
| 42 | Ga0466726_493337 | 3300042619 | Bacteria | 1068 |
| 43 | Ga0466728_459952 | 3300042620 | Bacteria | 1913 |
| 44 | Ga0466716_226618 | 3300042605 | Archaea | 2150 |
| 45 | Ga0466719_213534 | 3300042606 | Bacteria | 7211 |
| 46 | Ga0466722_132546 | 3300042609 | Bacteria | 27700 |
| 47 | Ga0466722_197203 | 3300042609 | Bacteria | 21912 |
| 48 | Ga0123356_10005738 | 3300010049 | Bacteria | 12601 |
| 49 | Nasutiter_Contig11804 | 2030936001 | Unclassified | 1752 |
| 50 | JGI24698J34947_10028831 | 3300002449 | Bacteria | 2937 |
| 51 | JGI24698J34947_10029324 | 3300002449 | Unclassified | 2907 |
| 52 | JGI24695J34938_10002619 | 3300002450 | Bacteria | 13510 |
| 53 | JGI24702J35022_10026614 | 3300002462 | Bacteria | 3114 |
| 54 | JGI24702J35022_10033457 | 3300002462 | Bacteria | 2750 |
| 55 | Ga0466702_108962 | 3300042635 | Bacteria | 2808 |
| 56 | Ga0466704_201868 | 3300042643 | Bacteria | 6255 |
| 57 | Ga0466727_258670 | 3300042655 | Bacteria | 1649 |
| 58 | Ga0264413_102317 | 3300024493 | Bacteria | 35625 |
| 59 | Ga0466690_029194 | 3300042590 | Bacteria | 6473 |
| 60 | Ga0466692_125362 | 3300042591 | Unclassified | 1132 |
| 61 | Ga0466694_136031 | 3300042594 | Bacteria | 3816 |
| 62 | Ga0466694_212037 | 3300042594 | Bacteria | 1477 |
| 63 | Ga0466699_121407 | 3300042597 | Bacteria | 11944 |
| 64 | Ga0466712_034773 | 3300042614 | Bacteria | 2796 |
| 65 | Ga0466712_242376 | 3300042614 | Bacteria | 4251 |
| 66 | Ga0466715_015556 | 3300042616 | Bacteria | 1158 |
| 67 | Ga0466715_202904 | 3300042616 | Bacteria | 11500 |
| 68 | Ga0466715_420493 | 3300042616 | Bacteria | 28208 |
| 69 | Ga0466718_046136 | 3300042617 | Bacteria | 7441 |
| 70 | Ga0466718_143143 | 3300042617 | Bacteria | 1353 |
| 71 | Ga0466723_061062 | 3300042618 | Bacteria | 33737 |
| 72 | Ga0466723_285899 | 3300042618 | Bacteria | 1440 |
| 73 | Ga0466726_005911 | 3300042619 | Bacteria | 3002 |
| 74 | Ga0466726_095691 | 3300042619 | Bacteria | 2510 |
| 75 | Ga0466728_012294 | 3300042620 | Bacteria | 1720 |
| 76 | Ga0466720_004408 | 3300042607 | Bacteria | 31853 |
| 77 | Ga0466722_170534 | 3300042609 | Bacteria | 7033 |
| 78 | Ga0123354_10199179 | 3300010882 | Bacteria | 2209 |
| 79 | AustNasuHG_c1003645 | 3300000089 | Bacteria | 5557 |
| 80 | JGI24698J34947_10005490 | 3300002449 | Bacteria | 6956 |
| 81 | JGI24698J34947_10010749 | 3300002449 | Bacteria | 5025 |
| 82 | Ga0072941_1099667 | 3300005201 | Bacteria | 2823 |
| 83 | Ga0466735_098785 | 3300042624 | Unclassified | 1852 |
| 84 | Ga0466727_037522 | 3300042655 | Bacteria | 8535 |
| 85 | Ga0466727_164610 | 3300042655 | Bacteria | 1680 |
| 86 | Ga0466732_258525 | 3300042656 | Bacteria | 2175 |
| 87 | Ga0466692_188500 | 3300042591 | Bacteria | 54661 |
| 88 | Ga0466699_003621 | 3300042597 | Bacteria | 2040 |
| 89 | Ga0466699_010743 | 3300042597 | Bacteria | 15176 |
| 90 | Ga0466699_149212 | 3300042597 | Bacteria | 34863 |
| 91 | Ga0466715_140890 | 3300042616 | Bacteria | 1143 |
| 92 | Ga0466718_002661 | 3300042617 | Bacteria | 4502 |
| 93 | Ga0466728_027633 | 3300042620 | Bacteria | 2938 |
| 94 | Ga0466728_209964 | 3300042620 | Bacteria | 1495 |
| 95 | Ga0466716_218606 | 3300042605 | Bacteria | 13881 |
| 96 | Ga0466720_040130 | 3300042607 | Unclassified | 9516 |
| 97 | Ga0466720_070717 | 3300042607 | Bacteria | 18617 |
| 98 | Ga0466722_055942 | 3300042609 | Bacteria | 6785 |
| 99 | Ga0466722_269060 | 3300042609 | Unclassified | 1462 |
| 100 | Ga0466698_078705 | 3300042610 | Bacteria | 1127 |
| 101 | Ga0123356_10731588 | 3300010049 | Bacteria | 1159 |
| 102 | JGI24698J34947_10005588 | 3300002449 | Bacteria | 6899 |
| 103 | JGI24698J34947_10020701 | 3300002449 | Bacteria | 3541 |
| 104 | JGI24698J34947_10062937 | 3300002449 | Unclassified | 1820 |
| 105 | Ga0072941_1123707 | 3300005201 | Bacteria | 5479 |
| 106 | Ga0466702_153243 | 3300042635 | Bacteria | 4309 |
| 107 | Ga0466703_187249 | 3300042636 | Unclassified | 1943 |
| 108 | Ga0466709_389754 | 3300042648 | Bacteria | 2726 |
| 109 | Ga0466727_345231 | 3300042655 | Bacteria | 1556 |
| 110 | Ga0466732_152030 | 3300042656 | Bacteria | 4136 |
| 111 | Ga0466690_026833 | 3300042590 | Bacteria | 4555 |
| 112 | Ga0466692_169971 | 3300042591 | Bacteria | 3555 |
| 113 | Ga0466696_041524 | 3300042596 | Bacteria | 17700 |
| 114 | Ga0466723_040611 | 3300042618 | Bacteria | 3598 |
| 115 | Ga0466726_045913 | 3300042619 | Bacteria | 2764 |
| 116 | Ga0466720_095225 | 3300042607 | Bacteria | 3982 |
| 117 | Ga0466720_121140 | 3300042607 | Bacteria | 42282 |
| 118 | Ga0466720_211893 | 3300042607 | Bacteria | 2765 |
| 119 | Ga0466722_174250 | 3300042609 | Unclassified | 1665 |
| 120 | JGI24698J34947_10028786 | 3300002449 | Bacteria | 2939 |
| 121 | Ga0466703_122239 | 3300042636 | Bacteria | 1382 |
| 122 | Ga0466708_258481 | 3300042652 | Bacteria | 2862 |
| 123 | Ga0466732_053553 | 3300042656 | Bacteria | 8600 |
| 124 | Ga0264413_100201 | 3300024493 | Bacteria | 5829 |
| 125 | Ga0264413_108935 | 3300024493 | Bacteria | 6198 |
| 126 | Ga0264413_130461 | 3300024493 | Bacteria | 3845 |
| 127 | Ga0466693_242383 | 3300042592 | Bacteria | 1497 |
| 128 | Ga0466694_105932 | 3300042594 | Bacteria | 49364 |
| 129 | Ga0466696_175964 | 3300042596 | Bacteria | 17378 |
| 130 | Ga0466696_376652 | 3300042596 | Bacteria | 8739 |
| 131 | Ga0466712_032763 | 3300042614 | Unclassified | 17655 |
| 132 | Ga0466712_048722 | 3300042614 | Bacteria | 18693 |
| 133 | Ga0466712_171124 | 3300042614 | Unclassified | 2103 |
| 134 | Ga0466718_042183 | 3300042617 | Bacteria | 62729 |
| 135 | Ga0466718_146476 | 3300042617 | Bacteria | 1131 |
| 136 | Ga0466716_304091 | 3300042605 | Bacteria | 13685 |
| 137 | Ga0466719_034033 | 3300042606 | Bacteria | 17474 |
| 138 | Ga0466719_115534 | 3300042606 | Bacteria | 6782 |
| 139 | Ga0466719_132429 | 3300042606 | Bacteria | 18918 |
| 140 | Ga0466720_116236 | 3300042607 | Unclassified | 1708 |
| 141 | Ga0466698_083422 | 3300042610 | Bacteria | 4244 |
| 142 | JGI24698J34947_10056847 | 3300002449 | Unclassified | 1943 |
| 143 | Ga0072940_1003540 | 3300005200 | Bacteria | 9036 |
| 144 | Ga0466703_013290 | 3300042636 | Bacteria | 6727 |
| 145 | Ga0466704_577674 | 3300042643 | Bacteria | 29271 |
| 146 | Ga0466709_380768 | 3300042648 | Bacteria | 1452 |
| 147 | Ga0466708_008559 | 3300042652 | Bacteria | 5224 |
| 148 | Ga0264413_100303 | 3300024493 | Unclassified | 11668 |
| 149 | Ga0466690_093739 | 3300042590 | Unclassified | 1000 |
| 150 | Ga0466690_298785 | 3300042590 | Bacteria | 3919 |
| 151 | Ga0466690_326287 | 3300042590 | Bacteria | 1222 |
| 152 | Ga0466692_015277 | 3300042591 | Bacteria | 12799 |
| 153 | Ga0466694_315860 | 3300042594 | Bacteria | 4186 |
| 154 | Ga0466694_379753 | 3300042594 | Bacteria | 3026 |
| 155 | Ga0466699_274050 | 3300042597 | Bacteria | 5824 |
| 156 | Ga0466715_007658 | 3300042616 | Bacteria | 1332 |
| 157 | Ga0466715_118289 | 3300042616 | Bacteria | 7820 |
| 158 | Ga0466718_026455 | 3300042617 | Bacteria | 3708 |
| 159 | Ga0466723_004283 | 3300042618 | Bacteria | 7963 |
| 160 | Ga0466726_175425 | 3300042619 | Bacteria | 12974 |
| 161 | Ga0466728_048438 | 3300042620 | Bacteria | 15653 |
| 162 | Ga0466716_180043 | 3300042605 | Bacteria | 2362 |
| 163 | Ga0466720_037487 | 3300042607 | Bacteria | 4985 |
| 164 | Ga0466720_228762 | 3300042607 | Bacteria | 6997 |
| 165 | Ga0123356_10043736 | 3300010049 | Bacteria | 4170 |
| 166 | AustNasuHG_c1000823 | 3300000089 | Bacteria | 11156 |
| 167 | JGI24698J34947_10008372 | 3300002449 | Bacteria | 5676 |
| 168 | Ga0072941_1020459 | 3300005201 | Bacteria | 2537 |
| 169 | Ga0072941_1095989 | 3300005201 | Bacteria | 2307 |
| 170 | Ga0072941_1192426 | 3300005201 | Bacteria | 1233 |
| 171 | Ga0466708_187482 | 3300042652 | Bacteria | 15879 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.