Protein Family IF04178
Metagenome
Isolate
184
Members
47
Samples
181
Scaffolds
274.22
Avg Length
Representative Sequence
- ID
- 3300024493|Ga0264413_120248|Ga0264413_1202482
- Length
- 259 aa
- Sequence
- MADIETLNDANFELYRDLIYKESGITFTPTNRSILESRLRERLREKGLTSMSDYLEKVKASKDELTGFLDSITTNLTRFFRNQAHFDALEKYVIPELINNIKKFPGTIRIWSAGCSTGEEPYTIAMLLSEILPKAWNFEILASDISLKCLMTAKEGFYAXXFDKVDGGYKVHPDIQAKIKFDYHNLKNDSQQRNLDIVFCRNVIIYFDEAAQTAVMGRFWDSMAPRSFLFIGHSESLFGMQTKFEFLKTEWATLYCKKA
Sample Types
Isolate
1.6%
Metagenome
98.4%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.4%
Kalotermitidae
31.1%
Unclassified
11.1%
Rhinotermitidae
6.7%
Termopsidae
6.7%
Taxonomy
Archaea
0
Bacteria
178
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 11 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 19 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 39 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 40 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 41 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 47 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_393162 | 3300042656 | Bacteria | 3129 |
| 2 | Ga0466690_171344 | 3300042590 | Bacteria | 1126 |
| 3 | Ga0466691_058612 | 3300042593 | Bacteria | 167737 |
| 4 | Ga0466691_181979 | 3300042593 | Bacteria | 35297 |
| 5 | Ga0466694_380829 | 3300042594 | Bacteria | 2742 |
| 6 | Ga0466695_274905 | 3300042595 | Bacteria | 1909 |
| 7 | Ga0466696_121884 | 3300042596 | Bacteria | 7090 |
| 8 | Ga0123357_10005186 | 3300009784 | Bacteria | 15551 |
| 9 | AustNasuHG_c1022607 | 3300000089 | Bacteria | 2018 |
| 10 | Ga0072940_1069876 | 3300005200 | Bacteria | 4588 |
| 11 | Ga0466719_250449 | 3300042606 | Bacteria | 11086 |
| 12 | Ga0466698_264361 | 3300042610 | Bacteria | 5674 |
| 13 | Ga0466731_422196 | 3300042622 | Bacteria | 6550 |
| 14 | Ga0466704_508630 | 3300042643 | Bacteria | 13196 |
| 15 | Ga0466709_156992 | 3300042648 | Bacteria | 1580 |
| 16 | Ga0466708_162738 | 3300042652 | Bacteria | 8523 |
| 17 | Ga0466727_159066 | 3300042655 | Bacteria | 1815 |
| 18 | Ga0466727_214684 | 3300042655 | Bacteria | 6376 |
| 19 | Ga0466705_423717 | 3300042612 | Bacteria | 3048 |
| 20 | Ga0466732_006503 | 3300042656 | Bacteria | 8244 |
| 21 | Ga0466732_272919 | 3300042656 | Bacteria | 1528 |
| 22 | Ga0466690_112171 | 3300042590 | Bacteria | 9693 |
| 23 | Ga0466691_076099 | 3300042593 | Bacteria | 1999 |
| 24 | Ga0123353_10012960 | 3300010167 | Bacteria | 11907 |
| 25 | Ga0123353_10047719 | 3300010167 | Bacteria | 6813 |
| 26 | JGI24698J34947_10016561 | 3300002449 | Bacteria | 3998 |
| 27 | Ga0466707_011953 | 3300042601 | Bacteria | 5184 |
| 28 | Ga0466716_348029 | 3300042605 | Bacteria | 4867 |
| 29 | Ga0466716_399436 | 3300042605 | Bacteria | 9047 |
| 30 | Ga0466720_017469 | 3300042607 | Bacteria | 2138 |
| 31 | Ga0466720_152384 | 3300042607 | Bacteria | 1430 |
| 32 | Ga0466704_125012 | 3300042643 | Bacteria | 1451 |
| 33 | Ga0466704_188363 | 3300042643 | Bacteria | 2946 |
| 34 | Ga0466708_214019 | 3300042652 | Bacteria | 4568 |
| 35 | Ga0466708_449574 | 3300042652 | Bacteria | 3646 |
| 36 | Ga0466727_299156 | 3300042655 | Bacteria | 5104 |
| 37 | Ga0466712_017163 | 3300042614 | Bacteria | 3817 |
| 38 | Ga0466715_049424 | 3300042616 | Bacteria | 22983 |
| 39 | Ga0466718_021677 | 3300042617 | Bacteria | 7619 |
| 40 | Ga0466726_299035 | 3300042619 | Bacteria | 1865 |
| 41 | Ga0466726_492851 | 3300042619 | Bacteria | 1359 |
| 42 | Ga0264413_120248 | 3300024493 | Bacteria | 2155 |
| 43 | Ga0466692_072568 | 3300042591 | Bacteria | 10468 |
| 44 | Ga0466691_024459 | 3300042593 | Bacteria | 9757 |
| 45 | Ga0466696_154800 | 3300042596 | Bacteria | 6464 |
| 46 | Ga0466699_057873 | 3300042597 | Bacteria | 2295 |
| 47 | Ga0466699_075566 | 3300042597 | Bacteria | 3110 |
| 48 | Ga0466699_424777 | 3300042597 | Bacteria | 3928 |
| 49 | Ga0123354_10220044 | 3300010882 | Bacteria | 2021 |
| 50 | JGI24698J34947_10007806 | 3300002449 | Bacteria | 5879 |
| 51 | Ga0466720_085782 | 3300042607 | Bacteria | 23553 |
| 52 | Ga0466698_432938 | 3300042610 | Unclassified | 1676 |
| 53 | Ga0466735_007293 | 3300042624 | Unclassified | 1311 |
| 54 | Ga0466703_127947 | 3300042636 | Bacteria | 15996 |
| 55 | Ga0466703_225310 | 3300042636 | Bacteria | 13720 |
| 56 | Ga0466709_247515 | 3300042648 | Bacteria | 1619 |
| 57 | Ga0466712_239305 | 3300042614 | Bacteria | 4767 |
| 58 | Ga0466711_043511 | 3300042615 | Bacteria | 1496 |
| 59 | Ga0466715_146528 | 3300042616 | Bacteria | 1648 |
| 60 | Ga0466718_007733 | 3300042617 | Bacteria | 1637 |
| 61 | Ga0466718_043112 | 3300042617 | Bacteria | 2248 |
| 62 | Ga0466718_085054 | 3300042617 | Bacteria | 3936 |
| 63 | Ga0466718_136679 | 3300042617 | Bacteria | 1001 |
| 64 | Ga0466723_033228 | 3300042618 | Bacteria | 6127 |
| 65 | Ga0466726_388935 | 3300042619 | Bacteria | 6702 |
| 66 | Ga0466728_054876 | 3300042620 | Bacteria | 1349 |
| 67 | Ga0466728_074364 | 3300042620 | Bacteria | 7291 |
| 68 | Ga0466732_204547 | 3300042656 | Bacteria | 5746 |
| 69 | Ga0466692_112283 | 3300042591 | Bacteria | 17018 |
| 70 | Ga0466692_205227 | 3300042591 | Bacteria | 1157 |
| 71 | Ga0466694_111982 | 3300042594 | Bacteria | 4195 |
| 72 | Ga0466696_047082 | 3300042596 | Bacteria | 15748 |
| 73 | Ga0123353_10447140 | 3300010167 | Unclassified | 1904 |
| 74 | Ga0466713_153553 | 3300042602 | Bacteria | 2152 |
| 75 | Ga0466717_289449 | 3300042604 | Bacteria | 1981 |
| 76 | Ga0466716_082061 | 3300042605 | Bacteria | 8764 |
| 77 | Ga0466716_122082 | 3300042605 | Bacteria | 11411 |
| 78 | Ga0466720_218726 | 3300042607 | Bacteria | 6763 |
| 79 | Ga0466698_377222 | 3300042610 | Bacteria | 1828 |
| 80 | Ga0466704_161605 | 3300042643 | Bacteria | 72612 |
| 81 | Ga0466709_108060 | 3300042648 | Bacteria | 10082 |
| 82 | Ga0466709_310469 | 3300042648 | Bacteria | 7914 |
| 83 | Ga0466708_123661 | 3300042652 | Bacteria | 13592 |
| 84 | Ga0466727_050025 | 3300042655 | Bacteria | 1596 |
| 85 | Ga0466727_095344 | 3300042655 | Bacteria | 4000 |
| 86 | Ga0466711_338200 | 3300042615 | Bacteria | 32469 |
| 87 | Ga0466711_502192 | 3300042615 | Bacteria | 57733 |
| 88 | Ga0466715_146130 | 3300042616 | Bacteria | 8286 |
| 89 | Ga0466718_054532 | 3300042617 | Bacteria | 1616 |
| 90 | Ga0466723_091625 | 3300042618 | Bacteria | 45311 |
| 91 | Ga0466726_073882 | 3300042619 | Unclassified | 1455 |
| 92 | Ga0466726_137121 | 3300042619 | Bacteria | 3100 |
| 93 | Ga0466728_020792 | 3300042620 | Bacteria | 5043 |
| 94 | Ga0466732_083522 | 3300042656 | Bacteria | 3803 |
| 95 | Ga0466732_390322 | 3300042656 | Bacteria | 7082 |
| 96 | Ga0466657_156882 | 3300042582 | Bacteria | 1100 |
| 97 | Ga0466690_234845 | 3300042590 | Bacteria | 9416 |
| 98 | Ga0466691_200069 | 3300042593 | Bacteria | 5898 |
| 99 | Ga0466699_368539 | 3300042597 | Bacteria | 12753 |
| 100 | Ga0123353_10012997 | 3300010167 | Bacteria | 11894 |
| 101 | JGI24698J34947_10061229 | 3300002449 | Bacteria | 1853 |
| 102 | JGI24698J34947_10077250 | 3300002449 | Bacteria | 1575 |
| 103 | JGI24702J35022_10007642 | 3300002462 | Bacteria | 6179 |
| 104 | Ga0466716_329313 | 3300042605 | Bacteria | 1904 |
| 105 | Ga0466719_164060 | 3300042606 | Bacteria | 7060 |
| 106 | Ga0466720_039402 | 3300042607 | Bacteria | 14005 |
| 107 | Ga0466722_057675 | 3300042609 | Bacteria | 6711 |
| 108 | Ga0466722_118584 | 3300042609 | Bacteria | 2397 |
| 109 | Ga0466705_004794 | 3300042612 | Bacteria | 4171 |
| 110 | Ga0466703_083521 | 3300042636 | Unclassified | 5567 |
| 111 | Ga0466703_169222 | 3300042636 | Bacteria | 13947 |
| 112 | Ga0466704_224994 | 3300042643 | Bacteria | 18385 |
| 113 | Ga0466704_302300 | 3300042643 | Bacteria | 26778 |
| 114 | Ga0466709_097750 | 3300042648 | Bacteria | 6047 |
| 115 | Ga0466709_191864 | 3300042648 | Bacteria | 3738 |
| 116 | Ga0466708_155385 | 3300042652 | Bacteria | 20713 |
| 117 | Ga0466708_288905 | 3300042652 | Bacteria | 6043 |
| 118 | Ga0466705_424940 | 3300042612 | Bacteria | 11497 |
| 119 | Ga0466715_108686 | 3300042616 | Bacteria | 11634 |
| 120 | Ga0466723_025018 | 3300042618 | Bacteria | 6454 |
| 121 | Ga0466728_108887 | 3300042620 | Bacteria | 19171 |
| 122 | Ga0466728_180489 | 3300042620 | Bacteria | 2491 |
| 123 | Ga0466732_268912 | 3300042656 | Bacteria | 5648 |
| 124 | Ga0466691_193722 | 3300042593 | Bacteria | 16775 |
| 125 | Ga0466694_031757 | 3300042594 | Bacteria | 45644 |
| 126 | Ga0466699_040256 | 3300042597 | Bacteria | 1210 |
| 127 | Ga0466699_205326 | 3300042597 | Bacteria | 2821 |
| 128 | Ga0123357_10183024 | 3300009784 | Bacteria | 2439 |
| 129 | AustNasuHG_c1003798 | 3300000089 | Bacteria | 5444 |
| 130 | JGI24696J40584_12918616 | 3300002834 | Bacteria | 1324 |
| 131 | Ga0466719_087254 | 3300042606 | Bacteria | 8952 |
| 132 | Ga0466720_025102 | 3300042607 | Bacteria | 5168 |
| 133 | Ga0466720_044947 | 3300042607 | Bacteria | 1823 |
| 134 | Ga0466705_357942 | 3300042612 | Bacteria | 12227 |
| 135 | Ga0466703_375960 | 3300042636 | Bacteria | 12205 |
| 136 | Ga0466704_467031 | 3300042643 | Bacteria | 1244 |
| 137 | Ga0466709_138451 | 3300042648 | Bacteria | 6435 |
| 138 | Ga0466709_337077 | 3300042648 | Bacteria | 1424 |
| 139 | Ga0466708_314056 | 3300042652 | Unclassified | 1971 |
| 140 | Ga0466708_321737 | 3300042652 | Bacteria | 61371 |
| 141 | Ga0466708_347895 | 3300042652 | Bacteria | 8189 |
| 142 | Ga0466715_003901 | 3300042616 | Bacteria | 26867 |
| 143 | Ga0466715_020469 | 3300042616 | Bacteria | 10846 |
| 144 | Ga0466718_064859 | 3300042617 | Bacteria | 21008 |
| 145 | Ga0466718_155678 | 3300042617 | Bacteria | 1548 |
| 146 | Ga0466718_162381 | 3300042617 | Bacteria | 35878 |
| 147 | Ga0466723_043615 | 3300042618 | Bacteria | 3926 |
| 148 | Ga0466692_123603 | 3300042591 | Bacteria | 40308 |
| 149 | Ga0466699_180067 | 3300042597 | Bacteria | 13967 |
| 150 | Ga0466699_355832 | 3300042597 | Bacteria | 1641 |
| 151 | JGI24698J34947_10077074 | 3300002449 | Bacteria | 1578 |
| 152 | Ga0466719_218411 | 3300042606 | Bacteria | 2274 |
| 153 | Ga0466720_044103 | 3300042607 | Bacteria | 7098 |
| 154 | Ga0466720_123101 | 3300042607 | Bacteria | 25348 |
| 155 | Ga0466705_197680 | 3300042612 | Bacteria | 4815 |
| 156 | Ga0466729_311663 | 3300042621 | Bacteria | 1656 |
| 157 | Ga0466703_087424 | 3300042636 | Bacteria | 9589 |
| 158 | Ga0466703_101873 | 3300042636 | Bacteria | 27649 |
| 159 | Ga0466703_239005 | 3300042636 | Bacteria | 3369 |
| 160 | Ga0466704_185919 | 3300042643 | Bacteria | 3593 |
| 161 | Ga0466708_274095 | 3300042652 | Bacteria | 2488 |
| 162 | Ga0466708_307138 | 3300042652 | Bacteria | 3687 |
| 163 | Ga0466727_072492 | 3300042655 | Bacteria | 8826 |
| 164 | Ga0466715_013605 | 3300042616 | Bacteria | 11959 |
| 165 | Ga0466715_566578 | 3300042616 | Bacteria | 2515 |
| 166 | Ga0466728_080723 | 3300042620 | Bacteria | 1840 |
| 167 | Ga0466729_115913 | 3300042621 | Bacteria | 1045 |
| 168 | Ga0466690_085965 | 3300042590 | Bacteria | 5929 |
| 169 | Ga0466694_145515 | 3300042594 | Bacteria | 16023 |
| 170 | Ga0466699_162214 | 3300042597 | Bacteria | 3332 |
| 171 | Ga0072940_1024477 | 3300005200 | Bacteria | 1810 |
| 172 | Ga0072941_1018167 | 3300005201 | Bacteria | 3677 |
| 173 | Ga0466700_124643 | 3300042600 | Bacteria | 1305 |
| 174 | Ga0466716_166008 | 3300042605 | Bacteria | 2400 |
| 175 | Ga0466720_193103 | 3300042607 | Bacteria | 1016 |
| 176 | Ga0466722_060233 | 3300042609 | Bacteria | 17242 |
| 177 | Ga0466698_026755 | 3300042610 | Bacteria | 18151 |
| 178 | Ga0466705_113094 | 3300042612 | Bacteria | 5384 |
| 179 | Ga0466703_362681 | 3300042636 | Bacteria | 2008 |
| 180 | Ga0466708_285282 | 3300042652 | Bacteria | 2167 |
| 181 | Ga0466712_000479 | 3300042614 | Bacteria | 10641 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.