Protein Family IF04162
Metagenome
Metatranscriptome
Isolate
133
Members
35
Samples
121
Scaffolds
157.56
Avg Length
Representative Sequence
- ID
- 3300024493|Ga0264413_106092|Ga0264413_10609211
- Length
- 150 aa
- Sequence
- MKKWVIFLIIGLSAAGFASAQVSRGGTLYVAVKSLNLKSSTGFFASNKGTLNYGDRVTVLQVSGKFVEVRSSANSSVSGWTPSANLSAKQVIAGSEIALAGKGFNQDVENAYKTKGNLNYADVDRVESVTVNEADLMRFLNEGRLAMGDN
Sample Types
Isolate
8.3%
Metagenome
90.2%
MAG
0.0%
Metatranscriptome
1.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
63.6%
Unclassified
33.3%
Rhinotermitidae
3.0%
Taxonomy
Archaea
0
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125649 | Treponema sp. Co191P3bin15 | Isolate | Unclassified |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 4 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 5 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 6 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 7 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 8 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 9 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 10 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 11 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 12 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 15 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 16 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 17 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 18 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 19 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 26 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 27 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 28 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 29 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 30 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 31 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 32 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 33 | 3300021245 | Termite gut microbial communities from nest from French Guiana - 11-4 mRNA SA | Metatranscriptome | Termitidae |
| 34 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 35 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_016499 | 3300042614 | Bacteria | 17539 |
| 2 | Ga0466712_065140 | 3300042614 | Bacteria | 9969 |
| 3 | Ga0466718_038965 | 3300042617 | Bacteria | 1351 |
| 4 | Ga0123356_10007355 | 3300010049 | Bacteria | 10993 |
| 5 | Ga0123356_10658335 | 3300010049 | Bacteria | 1215 |
| 6 | Ga0123356_11109452 | 3300010049 | Unclassified | 959 |
| 7 | Ga0466731_257314 | 3300042622 | Bacteria | 1898 |
| 8 | Ga0466722_242874 | 3300042609 | Bacteria | 2203 |
| 9 | JGI24698J34947_10008675 | 3300002449 | Bacteria | 5578 |
| 10 | JGI24698J34947_10017342 | 3300002449 | Bacteria | 3903 |
| 11 | JGI24698J34947_10051191 | 3300002449 | Bacteria | 2078 |
| 12 | JGI24697J35500_11267611 | 3300002507 | Bacteria | 3679 |
| 13 | Ga0072941_1038642 | 3300005201 | Bacteria | 13996 |
| 14 | Ga0072941_1134704 | 3300005201 | Bacteria | 3799 |
| 15 | Ga0466699_262514 | 3300042597 | Unclassified | 1812 |
| 16 | Ga0466718_000952 | 3300042617 | Unclassified | 3853 |
| 17 | Ga0466718_075740 | 3300042617 | Bacteria | 5851 |
| 18 | Ga0123356_10002142 | 3300010049 | Bacteria | 21275 |
| 19 | Ga0123356_10003457 | 3300010049 | Bacteria | 16528 |
| 20 | Ga0466700_440929 | 3300042600 | Bacteria | 3309 |
| 21 | Ga0466720_149852 | 3300042607 | Bacteria | 21676 |
| 22 | AustNasuHG_c1001153 | 3300000089 | Bacteria | 9478 |
| 23 | JGI24695J34938_10005157 | 3300002450 | Bacteria | 8266 |
| 24 | JGI24695J34938_10031814 | 3300002450 | Bacteria | 2444 |
| 25 | JGI24695J34938_10034618 | 3300002450 | Bacteria | 2316 |
| 26 | JGI24695J34938_10053927 | 3300002450 | Bacteria | 1746 |
| 27 | Ga0072941_1024568 | 3300005201 | Bacteria | 8675 |
| 28 | Ga0223683_1026792 | 3300021245 | Bacteria | 852 |
| 29 | Ga0264413_106092 | 3300024493 | Bacteria | 23480 |
| 30 | Ga0415639_024756 | 3300038395 | Bacteria | 11378 |
| 31 | Ga0466699_293414 | 3300042597 | Unclassified | 1082 |
| 32 | Ga0466699_383170 | 3300042597 | Bacteria | 2283 |
| 33 | Ga0466712_105182 | 3300042614 | Bacteria | 10769 |
| 34 | Ga0466712_165289 | 3300042614 | Bacteria | 9218 |
| 35 | Nasutiter_Contig26507 | 2030936001 | Unclassified | 689 |
| 36 | JGI24698J34947_10002247 | 3300002449 | Bacteria | 10344 |
| 37 | JGI24698J34947_10004948 | 3300002449 | Bacteria | 7304 |
| 38 | JGI24698J34947_10018202 | 3300002449 | Bacteria | 3799 |
| 39 | JGI24698J34947_10043203 | 3300002449 | Bacteria | 2312 |
| 40 | JGI24695J34938_10003432 | 3300002450 | Bacteria | 11086 |
| 41 | Ga0072941_1016761 | 3300005201 | Bacteria | 4378 |
| 42 | Ga0072941_1024556 | 3300005201 | Bacteria | 8562 |
| 43 | Ga0072941_1063238 | 3300005201 | Bacteria | 2543 |
| 44 | Ga0466699_161394 | 3300042597 | Bacteria | 3403 |
| 45 | Ga0466712_039160 | 3300042614 | Bacteria | 11059 |
| 46 | Ga0466712_052542 | 3300042614 | Bacteria | 6547 |
| 47 | Ga0466712_099406 | 3300042614 | Bacteria | 11271 |
| 48 | Ga0466718_005268 | 3300042617 | Bacteria | 1067 |
| 49 | Ga0123356_10004484 | 3300010049 | Bacteria | 14420 |
| 50 | Ga0123356_10218304 | 3300010049 | Unclassified | 1961 |
| 51 | Ga0466731_178371 | 3300042622 | Bacteria | 1056 |
| 52 | JGI24698J34947_10052911 | 3300002449 | Unclassified | 2035 |
| 53 | JGI24695J34938_10011870 | 3300002450 | Unclassified | 4658 |
| 54 | JGI24695J34938_10100789 | 3300002450 | Bacteria | 1180 |
| 55 | Ga0072941_1003069 | 3300005201 | Bacteria | 18829 |
| 56 | Ga0072941_1010357 | 3300005201 | Bacteria | 7479 |
| 57 | Ga0072941_1014918 | 3300005201 | Bacteria | 22266 |
| 58 | Ga0466699_078770 | 3300042597 | Bacteria | 26937 |
| 59 | Ga0466712_186934 | 3300042614 | Bacteria | 5213 |
| 60 | Ga0466712_218947 | 3300042614 | Bacteria | 2952 |
| 61 | Ga0466718_000886 | 3300042617 | Bacteria | 4979 |
| 62 | Ga0123356_10026398 | 3300010049 | Bacteria | 5451 |
| 63 | Ga0123356_10374424 | 3300010049 | Bacteria | 1555 |
| 64 | Ga0466722_018493 | 3300042609 | Bacteria | 4334 |
| 65 | JGI24695J34938_10000233 | 3300002450 | Bacteria | 52947 |
| 66 | JGI24695J34938_10014224 | 3300002450 | Bacteria | 4136 |
| 67 | JGI24695J34938_10059386 | 3300002450 | Unclassified | 1636 |
| 68 | JGI24699J35502_11129955 | 3300002509 | Bacteria | 4890 |
| 69 | Ga0072940_1010901 | 3300005200 | Bacteria | 11818 |
| 70 | Ga0415639_024421 | 3300038395 | Bacteria | 6775 |
| 71 | Ga0466699_141116 | 3300042597 | Bacteria | 14524 |
| 72 | Ga0466712_069505 | 3300042614 | Bacteria | 19297 |
| 73 | Ga0123356_10004679 | 3300010049 | Bacteria | 14090 |
| 74 | Ga0123356_10109782 | 3300010049 | Unclassified | 2662 |
| 75 | Ga0123356_11614688 | 3300010049 | Bacteria | 803 |
| 76 | Ga0123356_12236602 | 3300010049 | Bacteria | 684 |
| 77 | Ga0123353_10722114 | 3300010167 | Bacteria | 1393 |
| 78 | AustNasuHG_c1017821 | 3300000089 | Bacteria | 2354 |
| 79 | JGI24698J34947_10006282 | 3300002449 | Bacteria | 6530 |
| 80 | JGI24698J34947_10020358 | 3300002449 | Bacteria | 3573 |
| 81 | JGI24698J34947_10027839 | 3300002449 | Bacteria | 2997 |
| 82 | JGI24698J34947_10116001 | 3300002449 | Unclassified | 1172 |
| 83 | Ga0072941_1057212 | 3300005201 | Unclassified | 2718 |
| 84 | Ga0415639_025700 | 3300038395 | Bacteria | 3949 |
| 85 | Ga0466699_191454 | 3300042597 | Bacteria | 1021 |
| 86 | Ga0466699_224294 | 3300042597 | Bacteria | 1950 |
| 87 | Ga0466712_151730 | 3300042614 | Bacteria | 4616 |
| 88 | Ga0466712_288974 | 3300042614 | Unclassified | 4965 |
| 89 | Ga0466718_073711 | 3300042617 | Bacteria | 2137 |
| 90 | Ga0123356_10002801 | 3300010049 | Bacteria | 18479 |
| 91 | Ga0123356_10007354 | 3300010049 | Bacteria | 10993 |
| 92 | Ga0123356_10199135 | 3300010049 | Unclassified | 2041 |
| 93 | Ga0123356_11001658 | 3300010049 | Unclassified | 1006 |
| 94 | Ga0123356_12803138 | 3300010049 | Bacteria | 610 |
| 95 | Ga0466731_207582 | 3300042622 | Bacteria | 3599 |
| 96 | JGI24698J34947_10023695 | 3300002449 | Bacteria | 3283 |
| 97 | JGI24698J34947_10036477 | 3300002449 | Bacteria | 2560 |
| 98 | JGI24698J34947_10057746 | 3300002449 | Bacteria | 1924 |
| 99 | JGI24698J34947_10104016 | 3300002449 | Bacteria | 1269 |
| 100 | Ga0072941_1006242 | 3300005201 | Bacteria | 23661 |
| 101 | Ga0072941_1248118 | 3300005201 | Unclassified | 1637 |
| 102 | Ga0466694_005829 | 3300042594 | Bacteria | 5820 |
| 103 | Ga0466699_052680 | 3300042597 | Unclassified | 1473 |
| 104 | Ga0466699_231561 | 3300042597 | Bacteria | 1097 |
| 105 | Ga0466732_192650 | 3300042656 | Bacteria | 11505 |
| 106 | Ga0466712_013672 | 3300042614 | Bacteria | 27798 |
| 107 | Ga0123356_10002127 | 3300010049 | Bacteria | 21361 |
| 108 | Ga0123356_10043508 | 3300010049 | Bacteria | 4182 |
| 109 | Ga0123356_10139120 | 3300010049 | Bacteria | 2393 |
| 110 | Ga0123356_10681473 | 3300010049 | Unclassified | 1196 |
| 111 | Ga0466700_140225 | 3300042600 | Bacteria | 2314 |
| 112 | Ga0466720_147033 | 3300042607 | Bacteria | 48792 |
| 113 | Ga0466721_181848 | 3300042608 | Bacteria | 2302 |
| 114 | Ga0466722_189967 | 3300042609 | Bacteria | 4830 |
| 115 | JGI24698J34947_10008526 | 3300002449 | Bacteria | 5629 |
| 116 | JGI24698J34947_10017452 | 3300002449 | Bacteria | 3890 |
| 117 | Ga0072941_1024558 | 3300005201 | Bacteria | 12908 |
| 118 | Ga0072941_1117472 | 3300005201 | Unclassified | 3104 |
| 119 | Ga0223683_1035518 | 3300021245 | Unclassified | 882 |
| 120 | Ga0466693_315666 | 3300042592 | Unclassified | 1229 |
| 121 | Ga0466699_053886 | 3300042597 | Bacteria | 44491 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.