Protein Family IF04157

Metagenome Isolate
143 Members
48 Samples
129 Scaffolds
395.59 Avg Length

🧬 Representative Sequence

ID
3300024493|Ga0264413_103368|Ga0264413_1033682
Length
477 aa
Sequence
MKKEFYHALDKRTAKPCRLLMPHSVAPIKSPSVINVRSPLGDRQCAHEPSRTATRLRTISSWCSLWFMVKKFKRQIFLLFIIIVLNSSFNIYAQGLTISGILDTSVSMQAGAGDASDFLMGFEEYANIRFQSKLRDKAAIYGAVNFIAASGNYAANAKMMAGIGIGSPLNPTAYVYGENYIAGIELERLYFRLLGETVNFDGGLMRLPFGYGQVWGSSDFLNPRNPLKPDARPRAILGTAFFWYPTEETKLNVFYSAPRNPYSQEGDGSFIGLSFDKHWNKASIQTLYCFETPKKDSDYGIHRAGLSVKADLEVGLVIDALYTYNHEAQTKLDGLSFSGGVDYSFFDGNLILLAEYLYNGETSSTALGYGGSFSNNHYLYTGFTLRFNDYTNMSIALISGLNDISFTPVVTFNHDLFQGAVLTITAQVPLDRDLFSGDGNHGEFGPVPPDKLQPLLPITGERIGRYFDCTAKIRLRF

📊 Sample Types

Isolate 9.8%
Metagenome 90.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 37.0%
Unclassified 30.4%
Kalotermitidae 28.3%
Rhinotermitidae 4.3%

🌳 Taxonomy

Archaea 1
Bacteria 138
Eukaryota 0
Viruses 0
Unclassified 4

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
5 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
6 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
7 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
8 2778260935 Unclassified Fibrobacteres Co191P1bin79 Isolate Unclassified
9 2778260938 Unclassified Fibrobacteres Co191P3bin71 Isolate Unclassified
10 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
11 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
12 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
13 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
14 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
15 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
16 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
17 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
18 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
19 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
20 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
21 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
22 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
23 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 2820721785 Unclassified Fibrobacteres Lab288P1bin58 Isolate Unclassified
28 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
29 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
30 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
31 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
32 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
33 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
34 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
35 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
36 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
37 2781125658 Treponema sp. Emb289P3bin37 Isolate Unclassified
38 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
39 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
40 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
41 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
42 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
43 2781125693 Treponema sp. Th196P3bin148 Isolate Unclassified
44 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
45 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
46 2773857778 Unclassified Fibrobacteres Co191P1bin56 Isolate Unclassified
47 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
48 2781125662 Treponema sp. Emb289P3bin141 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_148630 3300042656 Bacteria 15820
2 Ga0123356_10000351 3300010049 Bacteria 52507
3 Ga0466716_210240 3300042605 Bacteria 36809
4 Ga0466720_063730 3300042607 Bacteria 6174
5 Ga0466712_285377 3300042614 Bacteria 3799
6 Ga0466718_060042 3300042617 Bacteria 9059
7 Ga0466718_131450 3300042617 Bacteria 2668
8 AustNasuHG_c1005441 3300000089 Bacteria 4551
9 AustNasuHG_c1007833 3300000089 Bacteria 3789
10 JGI24695J34938_10002220 3300002450 Bacteria 15105
11 JGI24695J34938_10006303 3300002450 Bacteria 7174
12 JGI24695J34938_10021807 3300002450 Bacteria 3124
13 Ga0072941_1005782 3300005201 Bacteria 12112
14 Ga0072941_1009401 3300005201 Bacteria 11127
15 Ga0264413_107760 3300024493 Bacteria 5672
16 Ga0264413_110438 3300024493 Bacteria 2724
17 Ga0264413_113985 3300024493 Bacteria 28252
18 Ga0466693_272869 3300042592 Bacteria 5920
19 Ga0466691_207569 3300042593 Bacteria 29392
20 Ga0466699_131420 3300042597 Bacteria 22068
21 Ga0123356_10370565 3300010049 Bacteria 1562
22 Ga0466719_135610 3300042606 Bacteria 8698
23 Ga0466712_067966 3300042614 Bacteria 5600
24 Ga0466712_165395 3300042614 Bacteria 2707
25 AustNasuHG_c1000245 3300000089 Bacteria 18355
26 JGI24698J34947_10008977 3300002449 Bacteria 5481
27 JGI24698J34947_10019780 3300002449 Bacteria 3628
28 JGI24695J34938_10000036 3300002450 Bacteria 101915
29 JGI24695J34938_10005278 3300002450 Bacteria 8119
30 Ga0072941_1010093 3300005201 Bacteria 4362
31 Ga0466690_299793 3300042590 Bacteria 3123
32 Ga0466692_131260 3300042591 Bacteria 16240
33 Ga0466694_047338 3300042594 Bacteria 2752
34 Ga0466694_095956 3300042594 Bacteria 1396
35 Ga0466695_380457 3300042595 Bacteria 78840
36 Ga0466696_316280 3300042596 Bacteria 7896
37 Ga0466705_372263 3300042612 Bacteria 9689
38 Ga0466709_292046 3300042648 Bacteria 3037
39 Ga0466732_299929 3300042656 Bacteria 7670
40 Ga0123356_10000612 3300010049 Bacteria 39404
41 Ga0123356_10001465 3300010049 Bacteria 26010
42 Ga0123356_10032752 3300010049 Bacteria 4860
43 Ga0466715_325419 3300042616 Bacteria 14030
44 JGI24698J34947_10000063 3300002449 Bacteria 33343
45 JGI24695J34938_10003243 3300002450 Bacteria 11509
46 JGI24695J34938_10003360 3300002450 Bacteria 11256
47 JGI24695J34938_10005544 3300002450 Bacteria 7829
48 Ga0072941_1005723 3300005201 Bacteria 33074
49 Ga0072941_1064434 3300005201 Bacteria 14628
50 Ga0415639_184125 3300038395 Bacteria 2917
51 Ga0466692_103249 3300042591 Bacteria 2103
52 Ga0466696_416059 3300042596 Bacteria 2337
53 Ga0466702_037390 3300042635 Bacteria 11627
54 Ga0466703_420558 3300042636 Bacteria 3618
55 Ga0466709_102114 3300042648 Bacteria 11300
56 Ga0123356_10108998 3300010049 Bacteria 2671
57 Ga0123356_10204139 3300010049 Bacteria 2019
58 Ga0466720_036413 3300042607 Bacteria 2948
59 Ga0466712_176548 3300042614 Bacteria 2136
60 JGI24698J34947_10004656 3300002449 Bacteria 7482
61 JGI24698J34947_10005392 3300002449 Bacteria 7016
62 Ga0072941_1005075 3300005201 Bacteria 8124
63 Ga0072941_1042015 3300005201 Bacteria 2734
64 Ga0264413_103368 3300024493 Bacteria 2620
65 Ga0264413_117295 3300024493 Bacteria 1568
66 Ga0415639_036066 3300038395 Bacteria 5499
67 Ga0415639_054665 3300038395 Bacteria 3351
68 Ga0466690_042710 3300042590 Bacteria 2663
69 Ga0466691_218458 3300042593 Bacteria 9075
70 Ga0466704_126527 3300042643 Bacteria 2589
71 Ga0466708_041247 3300042652 Bacteria 26897
72 Ga0466708_269645 3300042652 Bacteria 39521
73 Ga0466701_026942 3300042598 Bacteria 2491
74 Ga0466719_241809 3300042606 Bacteria 59103
75 Ga0466720_026398 3300042607 Bacteria 5853
76 Ga0466722_049313 3300042609 Bacteria 2441
77 Ga0466712_236371 3300042614 Bacteria 3555
78 Ga0466711_385720 3300042615 Bacteria 2025
79 Ga0466715_488342 3300042616 Archaea 3335
80 Ga0466718_039961 3300042617 Bacteria 3008
81 Ga0466718_089338 3300042617 Bacteria 11486
82 JGI24698J34947_10017104 3300002449 Bacteria 3934
83 JGI24698J34947_10021289 3300002449 Bacteria 3490
84 JGI24698J34947_10077226 3300002449 Bacteria 1575
85 JGI24698J34947_10090210 3300002449 Bacteria 1408
86 JGI24695J34938_10000998 3300002450 Bacteria 25695
87 Ga0072941_1014982 3300005201 Bacteria 8059
88 Ga0072941_1118992 3300005201 Bacteria 1413
89 Ga0466657_272500 3300042582 Bacteria 1700
90 Ga0466692_102496 3300042591 Bacteria 6892
91 Ga0466704_223905 3300042643 Bacteria 18923
92 Ga0466716_331558 3300042605 Bacteria 3953
93 Ga0466721_320483 3300042608 Unclassified 3070
94 Ga0466712_013430 3300042614 Bacteria 12564
95 Ga0466712_042362 3300042614 Bacteria 32694
96 Ga0466712_102126 3300042614 Bacteria 3480
97 Ga0466718_038596 3300042617 Bacteria 3339
98 JGI24698J34947_10014703 3300002449 Unclassified 4263
99 JGI24698J34947_10044463 3300002449 Bacteria 2273
100 JGI24698J34947_10089814 3300002449 Bacteria 1413
101 JGI24695J34938_10002311 3300002450 Bacteria 14683
102 JGI24695J34938_10003205 3300002450 Bacteria 11598
103 Ga0466692_128986 3300042591 Bacteria 6899
104 Ga0466691_157958 3300042593 Unclassified 2648
105 Ga0466694_241372 3300042594 Bacteria 1952
106 Ga0466703_204986 3300042636 Bacteria 6003
107 Ga0123356_10000706 3300010049 Bacteria 36942
108 Ga0123356_10032615 3300010049 Bacteria 4872
109 Ga0466712_017964 3300042614 Bacteria 12881
110 Ga0466712_112876 3300042614 Bacteria 6961
111 Ga0466712_172705 3300042614 Bacteria 2968
112 Ga0466718_039490 3300042617 Bacteria 2296
113 Ga0466723_030196 3300042618 Bacteria 35787
114 Ga0072941_1005669 3300005201 Bacteria 6741
115 Ga0466692_159107 3300042591 Bacteria 4031
116 Ga0466694_043111 3300042594 Bacteria 6949
117 Ga0466694_149803 3300042594 Bacteria 4619
118 Ga0466699_012834 3300042597 Bacteria 11441
119 Ga0466699_144765 3300042597 Bacteria 7569
120 Ga0466703_149340 3300042636 Unclassified 2407
121 Ga0466720_023164 3300042607 Bacteria 11554
122 Ga0466720_182937 3300042607 Bacteria 5637
123 Ga0466705_524023 3300042612 Bacteria 2997
124 Ga0466715_143927 3300042616 Bacteria 1383
125 JGI24698J34947_10003731 3300002449 Bacteria 8291
126 JGI24698J34947_10018782 3300002449 Bacteria 3732
127 JGI24695J34938_10001612 3300002450 Bacteria 18942
128 JGI24695J34938_10037063 3300002450 Bacteria 2219
129 Ga0466699_338613 3300042597 Bacteria 3891

🧩 MSA Aligner

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.