Protein Family IF03456
Metagenome
Isolate
134
Members
34
Samples
128
Scaffolds
165.85
Avg Length
Representative Sequence
- ID
- 3300010882|Ga0123354_10002028|Ga0123354_1000202816
- Length
- 183 aa
- Sequence
- MVKYREQFVCRGKLMSKLEIKKYGDSVLRKNNVSVEKITDEIKKLAADMLETMYAAPGVGLAAPQVGASLRMCVIDVGGEKKSPVIMINPVITEGENKISGEEGCLSFPGIYETVKRFEKVEAEYMDLNGKKKKVKADGFFAKAIQHEIDHLDSKLFIDYLPDWKRKAVEKEIKRRKKAGEW*
Sample Types
Isolate
4.5%
Metagenome
95.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
38.2%
Unclassified
26.5%
Termitidae
17.6%
Termopsidae
11.8%
Rhinotermitidae
5.9%
Taxonomy
Archaea
0
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820007728 | Unclassified Synergistetes Lab288P3bin114 | Isolate | Unclassified |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2754412483 | Unclassified Elusimicrobia Lab288P4bin38 | Isolate | Unclassified |
| 7 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 8 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 15 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 16 | 642555172 | Endomicrobium trichonymphae Rs-D17 | Isolate | Unclassified |
| 17 | 2754412482 | Unclassified Elusimicrobia Emb289P3bin85 | Isolate | Unclassified |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 20 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 21 | 2772190891 | Unclassified Elusimicrobia Emb289P1_bin41 | Isolate | Unclassified |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 28 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 29 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 30 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 31 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 32 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 33 | 2772190892 | Unclassified Elusimicrobia Lab288P3_bin37 | Isolate | Unclassified |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_033924 | 3300042601 | Bacteria | 28055 |
| 2 | Ga0466713_110936 | 3300042602 | Bacteria | 53952 |
| 3 | Ga0466713_113058 | 3300042602 | Bacteria | 4736 |
| 4 | Ga0466716_447745 | 3300042605 | Bacteria | 2987 |
| 5 | Ga0466719_522223 | 3300042606 | Bacteria | 1457 |
| 6 | Ga0466722_123498 | 3300042609 | Bacteria | 3395 |
| 7 | Ga0466690_240390 | 3300042590 | Bacteria | 2444 |
| 8 | Ga0466691_090513 | 3300042593 | Bacteria | 153342 |
| 9 | Ga0466696_234922 | 3300042596 | Bacteria | 1009 |
| 10 | Ga0466711_019253 | 3300042615 | Bacteria | 2113 |
| 11 | Ga0466711_123909 | 3300042615 | Bacteria | 8789 |
| 12 | Ga0466723_367122 | 3300042618 | Bacteria | 2318 |
| 13 | Ga0466726_007291 | 3300042619 | Bacteria | 92336 |
| 14 | Ga0466728_122373 | 3300042620 | Bacteria | 11971 |
| 15 | Ga0466735_028062 | 3300042624 | Bacteria | 20039 |
| 16 | Ga0466735_203919 | 3300042624 | Bacteria | 8422 |
| 17 | Ga0466703_250320 | 3300042636 | Bacteria | 592480 |
| 18 | Ga0068302_10471756 | 3300005071 | Bacteria | 2298 |
| 19 | Ga0466707_025271 | 3300042601 | Bacteria | 1333 |
| 20 | Ga0466713_079335 | 3300042602 | Bacteria | 100418 |
| 21 | Ga0466722_098708 | 3300042609 | Unclassified | 11730 |
| 22 | Ga0466722_201150 | 3300042609 | Bacteria | 18392 |
| 23 | Ga0466691_168448 | 3300042593 | Bacteria | 4163 |
| 24 | Ga0466711_517825 | 3300042615 | Bacteria | 192770 |
| 25 | Ga0466715_245922 | 3300042616 | Bacteria | 22093 |
| 26 | Ga0466715_252143 | 3300042616 | Bacteria | 34760 |
| 27 | Ga0466723_027742 | 3300042618 | Bacteria | 1468 |
| 28 | Ga0466723_108493 | 3300042618 | Unclassified | 10593 |
| 29 | Ga0466726_157152 | 3300042619 | Bacteria | 8545 |
| 30 | Ga0466704_179641 | 3300042643 | Bacteria | 1680 |
| 31 | Ga0466705_073813 | 3300042612 | Bacteria | 2546 |
| 32 | Ga0466705_202095 | 3300042612 | Bacteria | 20452 |
| 33 | Ga0466713_002719 | 3300042602 | Bacteria | 6553 |
| 34 | Ga0466691_079083 | 3300042593 | Bacteria | 35903 |
| 35 | Ga0466696_082737 | 3300042596 | Bacteria | 7013 |
| 36 | Ga0466711_019828 | 3300042615 | Bacteria | 3345 |
| 37 | Ga0466711_217973 | 3300042615 | Bacteria | 218633 |
| 38 | Ga0466711_284350 | 3300042615 | Bacteria | 47567 |
| 39 | Ga0466726_006259 | 3300042619 | Bacteria | 39671 |
| 40 | Ga0466726_047707 | 3300042619 | Bacteria | 62318 |
| 41 | Ga0466726_102598 | 3300042619 | Bacteria | 1092 |
| 42 | Ga0466726_262606 | 3300042619 | Bacteria | 1169 |
| 43 | Ga0466729_062818 | 3300042621 | Bacteria | 7038 |
| 44 | Ga0123353_10000756 | 3300010167 | Bacteria | 39216 |
| 45 | Ga0466708_241664 | 3300042652 | Bacteria | 33170 |
| 46 | Ga0466727_093490 | 3300042655 | Bacteria | 9352 |
| 47 | Ga0466727_150924 | 3300042655 | Bacteria | 116830 |
| 48 | Ga0466727_182732 | 3300042655 | Bacteria | 7996 |
| 49 | Ga0068302_10403383 | 3300005071 | Unclassified | 757 |
| 50 | Ga0068305_10002976 | 3300005083 | Unclassified | 5899 |
| 51 | Ga0466707_281640 | 3300042601 | Bacteria | 2549 |
| 52 | Ga0466719_272400 | 3300042606 | Bacteria | 1217 |
| 53 | Ga0466722_057605 | 3300042609 | Bacteria | 1027 |
| 54 | Ga0415639_032427 | 3300038395 | Bacteria | 2981 |
| 55 | Ga0466696_178088 | 3300042596 | Bacteria | 1564 |
| 56 | Ga0466711_012250 | 3300042615 | Bacteria | 4061 |
| 57 | Ga0466723_351944 | 3300042618 | Bacteria | 1821 |
| 58 | Ga0466726_089939 | 3300042619 | Bacteria | 31858 |
| 59 | Ga0466726_363696 | 3300042619 | Bacteria | 3853 |
| 60 | Ga0466728_220577 | 3300042620 | Bacteria | 3732 |
| 61 | Ga0466729_065651 | 3300042621 | Bacteria | 24032 |
| 62 | Ga0123356_10000001 | 3300010049 | Bacteria | 411946 |
| 63 | Ga0466735_055929 | 3300042624 | Bacteria | 7576 |
| 64 | Ga0466704_313752 | 3300042643 | Bacteria | 7824 |
| 65 | Ga0466704_332451 | 3300042643 | Bacteria | 56221 |
| 66 | Ga0466708_010981 | 3300042652 | Bacteria | 3498 |
| 67 | Ga0466708_014549 | 3300042652 | Bacteria | 29514 |
| 68 | Ga0466708_267038 | 3300042652 | Bacteria | 33514 |
| 69 | Ga0068305_10002975 | 3300005083 | Bacteria | 3976 |
| 70 | Ga0466705_095138 | 3300042612 | Bacteria | 32491 |
| 71 | Ga0466713_046830 | 3300042602 | Bacteria | 25753 |
| 72 | Ga0466716_073035 | 3300042605 | Bacteria | 6822 |
| 73 | Ga0466719_124172 | 3300042606 | Bacteria | 1211 |
| 74 | Ga0466690_105296 | 3300042590 | Bacteria | 3669 |
| 75 | Ga0466696_343185 | 3300042596 | Bacteria | 1999 |
| 76 | Ga0466711_205726 | 3300042615 | Bacteria | 2436 |
| 77 | Ga0466711_291046 | 3300042615 | Bacteria | 1329 |
| 78 | Ga0466715_163767 | 3300042616 | Bacteria | 17363 |
| 79 | Ga0466723_014494 | 3300042618 | Bacteria | 2266 |
| 80 | Ga0466723_126391 | 3300042618 | Bacteria | 53736 |
| 81 | Ga0466728_255384 | 3300042620 | Bacteria | 1487 |
| 82 | Ga0123357_10581021 | 3300009784 | Bacteria | 873 |
| 83 | Ga0466735_022774 | 3300042624 | Bacteria | 14643 |
| 84 | Ga0466703_176069 | 3300042636 | Bacteria | 1634 |
| 85 | Ga0466708_428202 | 3300042652 | Bacteria | 14731 |
| 86 | Ga0466727_034558 | 3300042655 | Bacteria | 1376 |
| 87 | Ga0068302_10004055 | 3300005071 | Unclassified | 16629 |
| 88 | Ga0466705_192402 | 3300042612 | Bacteria | 3712 |
| 89 | Ga0466719_095138 | 3300042606 | Bacteria | 4700 |
| 90 | Ga0466715_187337 | 3300042616 | Bacteria | 26584 |
| 91 | Ga0466715_367996 | 3300042616 | Bacteria | 1104 |
| 92 | Ga0466715_520904 | 3300042616 | Bacteria | 18843 |
| 93 | Ga0466723_055079 | 3300042618 | Bacteria | 28990 |
| 94 | Ga0466726_275498 | 3300042619 | Bacteria | 12078 |
| 95 | Ga0466728_006430 | 3300042620 | Bacteria | 4678 |
| 96 | Ga0466729_076163 | 3300042621 | Bacteria | 5402 |
| 97 | Ga0123354_10002028 | 3300010882 | Bacteria | 26086 |
| 98 | Ga0466729_286194 | 3300042621 | Bacteria | 3307 |
| 99 | Ga0466727_308731 | 3300042655 | Bacteria | 3041 |
| 100 | Ga0068305_10000168 | 3300005083 | Bacteria | 304006 |
| 101 | Ga0466707_337622 | 3300042601 | Bacteria | 7958 |
| 102 | Ga0466719_079675 | 3300042606 | Bacteria | 16497 |
| 103 | Ga0466719_524336 | 3300042606 | Bacteria | 382683 |
| 104 | Ga0466690_073155 | 3300042590 | Bacteria | 19855 |
| 105 | Ga0466690_119001 | 3300042590 | Bacteria | 17937 |
| 106 | Ga0466691_122822 | 3300042593 | Bacteria | 31809 |
| 107 | Ga0466696_267161 | 3300042596 | Bacteria | 2459 |
| 108 | Ga0466711_012686 | 3300042615 | Bacteria | 31029 |
| 109 | Ga0466711_024820 | 3300042615 | Bacteria | 11146 |
| 110 | Ga0466715_098538 | 3300042616 | Bacteria | 131452 |
| 111 | Ga0466723_215876 | 3300042618 | Bacteria | 38493 |
| 112 | Ga0123353_10345919 | 3300010167 | Bacteria | 2244 |
| 113 | Ga0466735_005334 | 3300042624 | Bacteria | 1452 |
| 114 | Ga0466735_226656 | 3300042624 | Bacteria | 8301 |
| 115 | Ga0466708_339441 | 3300042652 | Bacteria | 13909 |
| 116 | Ga0466714_168788 | 3300042603 | Bacteria | 4036 |
| 117 | Ga0466696_390706 | 3300042596 | Bacteria | 2057 |
| 118 | Ga0466705_423024 | 3300042612 | Bacteria | 4101 |
| 119 | Ga0466711_088036 | 3300042615 | Bacteria | 6224 |
| 120 | Ga0466711_457060 | 3300042615 | Bacteria | 1637 |
| 121 | Ga0466715_419019 | 3300042616 | Bacteria | 23713 |
| 122 | Ga0466723_174648 | 3300042618 | Bacteria | 29562 |
| 123 | Ga0123357_10011136 | 3300009784 | Bacteria | 11507 |
| 124 | Ga0466729_271329 | 3300042621 | Bacteria | 3087 |
| 125 | Ga0466735_100695 | 3300042624 | Bacteria | 5142 |
| 126 | Ga0466735_119023 | 3300042624 | Bacteria | 7844 |
| 127 | Ga0466703_307944 | 3300042636 | Bacteria | 1346 |
| 128 | Ga0466708_273284 | 3300042652 | Bacteria | 22143 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01327 | Pep_deformylase | Polypeptide deformylase | 18 | 166 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01327 | GO:0042586 | peptide deformylase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.