Protein Family IF03428
Metagenome
Isolate
119
Members
42
Samples
116
Scaffolds
127.62
Avg Length
Representative Sequence
- ID
- 3300010167|Ga0123353_12753684|Ga0123353_127536841
- Length
- 152 aa
- Sequence
- LEKQAGYEECRTIREEPQKRQKAVIIDTDVLIWYLRGNENARKIIDANIPFRISVINYLELLQGMKDKRELHILQKCLREWSTEIIQINENISSRAMFFVEDYYLSHSMELADAIVAATVLEHHEVLLTANEKHYSFIPNIQINRFRPGQK*
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
62.5%
Kalotermitidae
17.5%
Unclassified
10.0%
Termopsidae
7.5%
Rhinotermitidae
2.5%
Taxonomy
Archaea
0
Bacteria
108
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 2 | 2820010479 | Unclassified Spirochaetes Th196P4bin55 | Isolate | Unclassified |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 13 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 14 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 15 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 16 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 21 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 22 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 23 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 24 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 29 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 30 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 39 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_204595 | 3300042659 | Bacteria | 1413 |
| 2 | Ga0466715_350183 | 3300042616 | Bacteria | 4812 |
| 3 | Ga0466718_014025 | 3300042617 | Bacteria | 1590 |
| 4 | Ga0466718_053325 | 3300042617 | Unclassified | 3075 |
| 5 | Ga0466726_123725 | 3300042619 | Bacteria | 1177 |
| 6 | Ga0466726_492159 | 3300042619 | Bacteria | 1516 |
| 7 | Ga0123356_11064322 | 3300010049 | Bacteria | 978 |
| 8 | Ga0123353_11571755 | 3300010167 | Bacteria | 833 |
| 9 | Ga0123353_12753684 | 3300010167 | Bacteria | 577 |
| 10 | Ga0264413_100339 | 3300024493 | Bacteria | 2347 |
| 11 | Ga0415639_199401 | 3300038395 | Bacteria | 2324 |
| 12 | Ga0466691_047991 | 3300042593 | Bacteria | 1606 |
| 13 | Ga0466699_059056 | 3300042597 | Bacteria | 1621 |
| 14 | Ga0466699_442867 | 3300042597 | Bacteria | 1544 |
| 15 | Ga0466701_085248 | 3300042598 | Bacteria | 1560 |
| 16 | Ga0466717_156123 | 3300042604 | Bacteria | 1975 |
| 17 | Ga0466720_099504 | 3300042607 | Bacteria | 16735 |
| 18 | Ga0466698_203760 | 3300042610 | Bacteria | 4500 |
| 19 | JGI24702J35022_10003038 | 3300002462 | Bacteria | 10144 |
| 20 | JGI24705J35276_12019363 | 3300002504 | Bacteria | 872 |
| 21 | Ga0123356_11657536 | 3300010049 | Bacteria | 793 |
| 22 | Ga0123353_11165658 | 3300010167 | Bacteria | 1015 |
| 23 | Ga0123353_11194270 | 3300010167 | Bacteria | 999 |
| 24 | Ga0466699_083055 | 3300042597 | Bacteria | 2289 |
| 25 | Ga0466699_223060 | 3300042597 | Unclassified | 1065 |
| 26 | Ga0466699_324391 | 3300042597 | Bacteria | 3644 |
| 27 | Ga0466720_015681 | 3300042607 | Bacteria | 8120 |
| 28 | Ga0466720_195145 | 3300042607 | Bacteria | 14789 |
| 29 | Ga0466721_167584 | 3300042608 | Bacteria | 1848 |
| 30 | JGI24702J35022_10263256 | 3300002462 | Bacteria | 1007 |
| 31 | Ga0466705_389041 | 3300042612 | Bacteria | 1089 |
| 32 | Ga0466718_050323 | 3300042617 | Bacteria | 16197 |
| 33 | Ga0123357_10081903 | 3300009784 | Bacteria | 4240 |
| 34 | Ga0123356_10550230 | 3300010049 | Bacteria | 1315 |
| 35 | Ga0123356_10814634 | 3300010049 | Bacteria | 1105 |
| 36 | Ga0123356_11398419 | 3300010049 | Bacteria | 860 |
| 37 | Ga0466690_071118 | 3300042590 | Bacteria | 1586 |
| 38 | Ga0466691_000981 | 3300042593 | Bacteria | 3379 |
| 39 | Ga0466699_021062 | 3300042597 | Bacteria | 1806 |
| 40 | Ga0466701_099301 | 3300042598 | Bacteria | 1298 |
| 41 | Ga0466720_005141 | 3300042607 | Unclassified | 2470 |
| 42 | Ga0466722_120296 | 3300042609 | Bacteria | 1078 |
| 43 | JGI24698J34947_10239791 | 3300002449 | Bacteria | 684 |
| 44 | Ga0072941_1036577 | 3300005201 | Bacteria | 3677 |
| 45 | Ga0466718_138007 | 3300042617 | Bacteria | 2799 |
| 46 | Ga0466726_041706 | 3300042619 | Bacteria | 11060 |
| 47 | Ga0123357_10549265 | 3300009784 | Unclassified | 923 |
| 48 | Ga0123356_10000612 | 3300010049 | Bacteria | 39404 |
| 49 | Ga0123356_11737173 | 3300010049 | Bacteria | 775 |
| 50 | Ga0123353_10039535 | 3300010167 | Bacteria | 7427 |
| 51 | Ga0123353_10232627 | 3300010167 | Bacteria | 2872 |
| 52 | Ga0123353_12509099 | 3300010167 | Bacteria | 613 |
| 53 | Ga0466694_298193 | 3300042594 | Bacteria | 1021 |
| 54 | Ga0466720_038784 | 3300042607 | Bacteria | 9058 |
| 55 | Ga0466720_065987 | 3300042607 | Unclassified | 1581 |
| 56 | Ga0466703_148408 | 3300042636 | Unclassified | 2742 |
| 57 | Ga0466727_334460 | 3300042655 | Bacteria | 6087 |
| 58 | JGI24702J35022_10234419 | 3300002462 | Bacteria | 1062 |
| 59 | Ga0466733_021260 | 3300042659 | Bacteria | 2085 |
| 60 | Ga0466711_325398 | 3300042615 | Bacteria | 1165 |
| 61 | Ga0466711_469257 | 3300042615 | Bacteria | 1216 |
| 62 | Ga0466715_026581 | 3300042616 | Bacteria | 3081 |
| 63 | Ga0466715_080933 | 3300042616 | Bacteria | 1527 |
| 64 | Ga0466718_012367 | 3300042617 | Bacteria | 4961 |
| 65 | Ga0466726_027698 | 3300042619 | Bacteria | 1177 |
| 66 | Ga0123356_11512326 | 3300010049 | Bacteria | 829 |
| 67 | Ga0123353_10282984 | 3300010167 | Bacteria | 2545 |
| 68 | Ga0123354_10189231 | 3300010882 | Bacteria | 2312 |
| 69 | Ga0466694_001167 | 3300042594 | Bacteria | 1464 |
| 70 | Ga0466694_102889 | 3300042594 | Bacteria | 1191 |
| 71 | Ga0466707_372239 | 3300042601 | Bacteria | 1284 |
| 72 | Ga0466731_207687 | 3300042622 | Bacteria | 1201 |
| 73 | Ga0466731_288534 | 3300042622 | Bacteria | 1733 |
| 74 | Ga0466734_056943 | 3300042623 | Bacteria | 2080 |
| 75 | Ga0466702_312562 | 3300042635 | Bacteria | 2991 |
| 76 | Ga0466727_261315 | 3300042655 | Bacteria | 1714 |
| 77 | Ga0466705_263000 | 3300042612 | Bacteria | 5125 |
| 78 | Ga0466710_064810 | 3300042613 | Bacteria | 1142 |
| 79 | Ga0466718_097376 | 3300042617 | Bacteria | 5026 |
| 80 | Ga0466718_130478 | 3300042617 | Bacteria | 1545 |
| 81 | Ga0123356_10054915 | 3300010049 | Bacteria | 3709 |
| 82 | Ga0123356_11078187 | 3300010049 | Bacteria | 972 |
| 83 | Ga0264413_100338 | 3300024493 | Unclassified | 2171 |
| 84 | Ga0466693_057370 | 3300042592 | Bacteria | 1924 |
| 85 | Ga0466699_186602 | 3300042597 | Bacteria | 3388 |
| 86 | Ga0466707_212817 | 3300042601 | Bacteria | 1393 |
| 87 | Ga0466720_029638 | 3300042607 | Bacteria | 2652 |
| 88 | Ga0466731_177424 | 3300042622 | Unclassified | 1282 |
| 89 | Ga0466731_198530 | 3300042622 | Unclassified | 1116 |
| 90 | Ga0466703_008826 | 3300042636 | Bacteria | 5158 |
| 91 | Ga0466708_434199 | 3300042652 | Bacteria | 2457 |
| 92 | JGI24695J34938_10016312 | 3300002450 | Bacteria | 3781 |
| 93 | JGI24702J35022_10003431 | 3300002462 | Bacteria | 9554 |
| 94 | JGI24702J35022_10009655 | 3300002462 | Unclassified | 5411 |
| 95 | JGI24702J35022_10055030 | 3300002462 | Bacteria | 2122 |
| 96 | Ga0072941_1201885 | 3300005201 | Bacteria | 871 |
| 97 | Ga0072941_1204669 | 3300005201 | Bacteria | 817 |
| 98 | Ga0466712_072532 | 3300042614 | Bacteria | 1475 |
| 99 | Ga0123357_10274803 | 3300009784 | Bacteria | 1753 |
| 100 | Ga0123356_10612625 | 3300010049 | Bacteria | 1254 |
| 101 | Ga0123353_12445006 | 3300010167 | Bacteria | 623 |
| 102 | Ga0415639_106385 | 3300038395 | Bacteria | 1079 |
| 103 | Ga0466690_152300 | 3300042590 | Bacteria | 1983 |
| 104 | JGI24702J35022_10007985 | 3300002462 | Bacteria | 6023 |
| 105 | JGI24705J35276_12149476 | 3300002504 | Bacteria | 1176 |
| 106 | Ga0466718_010546 | 3300042617 | Unclassified | 1826 |
| 107 | Ga0466718_170007 | 3300042617 | Bacteria | 2965 |
| 108 | Ga0466726_352271 | 3300042619 | Bacteria | 1733 |
| 109 | Ga0466691_228083 | 3300042593 | Bacteria | 17847 |
| 110 | Ga0466694_045824 | 3300042594 | Bacteria | 1019 |
| 111 | Ga0466695_148123 | 3300042595 | Bacteria | 1212 |
| 112 | Ga0466699_088724 | 3300042597 | Bacteria | 6253 |
| 113 | Ga0466699_367849 | 3300042597 | Bacteria | 1897 |
| 114 | Ga0466707_323230 | 3300042601 | Bacteria | 1162 |
| 115 | Ga0466735_201840 | 3300042624 | Bacteria | 2980 |
| 116 | JGI24695J34938_10050941 | 3300002450 | Bacteria | 1814 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01850 | PIN | PIN domain | 24 | 134 | 0.82 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.