Protein Family IF03038

Metagenome Isolate
161 Members
48 Samples
148 Scaffolds
277.08 Avg Length

🧬 Representative Sequence

ID
3300010167|Ga0123353_10001926|Ga0123353_100019264
Length
319 aa
Sequence
VSQKGSIFCAKWHCFISWSLENGCCSVGGLNCNKSETNKKGTIMSNINIGMNLEATRHHDKPFEWGLDHAAEMGYKYVEPMVHFGRELMSEAGYYHTWSMFNDPMKMRRMCEDRGLKISGLQAHGPLGRPDRHGDYLKSAIRFAAECGAPVVNTDEGIKAPWTTEAEDWVLIRYTLQEAAFFAEERGIKIGLECHAQYSKTPEGLEKLYRLVDSPCMGFNLDTGNAYLAGQDPYQWLEQVIDRSVHLHAKDISVQHSDDERGKVTGTPVGCACGDGVIDWKRMVDIAKKCPRDIVFSVECGTIEQAKRSLEHLKKIIE*

📊 Sample Types

Isolate 8.1%
Metagenome 91.9%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 34.0%
Kalotermitidae 27.7%
Unclassified 25.5%
Termopsidae 6.4%
Rhinotermitidae 4.3%
Passalidae 2.1%

🌳 Taxonomy

Archaea 1
Bacteria 119
Eukaryota 0
Viruses 0
Unclassified 41

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
2 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
3 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
4 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
5 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
6 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
7 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
8 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
9 2820185449 Unclassified Planctomycetes Lab288P3bin146 Isolate Unclassified
10 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
11 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 2820201435 Unclassified Planctomycetes Cu122P5bin25 Isolate Unclassified
14 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
15 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
16 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
17 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
18 2820180635 Unclassified Planctomycetes Lab288P3bin24 Isolate Unclassified
19 2820196379 Unclassified Planctomycetes Emb289P3bin158 Isolate Unclassified
20 2820209022 Unclassified Kiritimatiellaeota Th196P3bin76 Isolate Unclassified
21 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
22 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
23 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
24 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
25 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
26 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
27 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
28 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
29 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
30 2820211246 Unclassified Kiritimatiellaeota Nt197P3bin96 Isolate Unclassified
31 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
32 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
33 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
34 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
35 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
36 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
37 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
38 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
39 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
40 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
41 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
42 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
43 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
44 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
45 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
46 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
47 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
48 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466711_484593 3300042615 Bacteria 2716
2 Ga0466728_429110 3300042620 Bacteria 3211
3 Ga0123356_10241198 3300010049 Unclassified 1879
4 Ga0123356_11175594 3300010049 Unclassified 934
5 Ga0466716_084810 3300042605 Bacteria 10896
6 Ga0466716_146861 3300042605 Bacteria 3840
7 Ga0466716_202439 3300042605 Bacteria 8449
8 Ga0466719_316141 3300042606 Bacteria 5216
9 Ga0466729_239237 3300042621 Bacteria 3959
10 Ga0466729_307592 3300042621 Unclassified 2416
11 Ga0466734_063431 3300042623 Unclassified 6395
12 Ga0466703_240665 3300042636 Bacteria 5337
13 Ga0466704_303430 3300042643 Unclassified 2088
14 Ga0466690_430421 3300042590 Unclassified 3495
15 Ga0466693_239100 3300042592 Unclassified 1125
16 Ga0466695_135903 3300042595 Bacteria 1010
17 Ga0466705_205692 3300042612 Bacteria 9463
18 Ga0466711_081059 3300042615 Bacteria 3453
19 Ga0466715_098206 3300042616 Unclassified 1419
20 Ga0466715_431608 3300042616 Unclassified 2007
21 Ga0466715_566576 3300042616 Unclassified 7926
22 Ga0466718_093128 3300042617 Bacteria 2978
23 Ga0466729_133179 3300042621 Bacteria 1218
24 2227481329 2225789004 Bacteria 4421
25 Ga0072941_1060136 3300005201 Bacteria 2595
26 Ga0123356_10456844 3300010049 Unclassified 1426
27 Ga0123353_10023305 3300010167 Bacteria 9367
28 Ga0123353_10177259 3300010167 Bacteria 3378
29 Ga0123353_10267686 3300010167 Bacteria 2635
30 Ga0123353_10282323 3300010167 Bacteria 2549
31 Ga0123353_10314619 3300010167 Bacteria 2380
32 Ga0123353_10785781 3300010167 Bacteria 1317
33 Ga0466716_264195 3300042605 Bacteria 3024
34 Ga0466719_056242 3300042606 Unclassified 10883
35 Ga0466729_276186 3300042621 Bacteria 3104
36 Ga0466704_138188 3300042643 Bacteria 3743
37 Ga0466727_078524 3300042655 Bacteria 5393
38 Ga0466693_190492 3300042592 Bacteria 2491
39 Ga0466696_105433 3300042596 Unclassified 3765
40 Ga0466696_449841 3300042596 Bacteria 5298
41 Ga0466715_264012 3300042616 Unclassified 5306
42 Ga0466728_132256 3300042620 Unclassified 2891
43 JGI24695J34938_10036292 3300002450 Unclassified 2248
44 JGI24702J35022_10041974 3300002462 Bacteria 2437
45 Ga0123356_10177623 3300010049 Unclassified 2147
46 Ga0123356_10327476 3300010049 Unclassified 1647
47 Ga0123353_10005726 3300010167 Bacteria 16394
48 Ga0123353_10021395 3300010167 Bacteria 9707
49 Ga0123353_10304929 3300010167 Unclassified 2428
50 Ga0123353_10366634 3300010167 Bacteria 2162
51 Ga0123354_10366767 3300010882 Bacteria 1262
52 Ga0466703_049965 3300042636 Archaea 3545
53 Ga0466690_288661 3300042590 Unclassified 2620
54 Ga0466712_241033 3300042614 Bacteria 1777
55 Ga0466723_164975 3300042618 Bacteria 1947
56 JGI24702J35022_10018683 3300002462 Bacteria 3777
57 Ga0123353_10001578 3300010167 Bacteria 28002
58 Ga0123353_10004651 3300010167 Bacteria 17727
59 Ga0123353_10172699 3300010167 Bacteria 3429
60 Ga0123353_10228363 3300010167 Bacteria 2904
61 Ga0123353_10338548 3300010167 Unclassified 2273
62 Ga0466716_352660 3300042605 Bacteria 1084
63 Ga0466729_299381 3300042621 Unclassified 17381
64 Ga0466731_404128 3300042622 Bacteria 1030
65 Ga0466704_305415 3300042643 Bacteria 3520
66 Ga0466708_085363 3300042652 Bacteria 46294
67 Ga0466691_150312 3300042593 Bacteria 5947
68 Ga0466715_114094 3300042616 Bacteria 20099
69 Ga0466729_130384 3300042621 Bacteria 8502
70 JGI24702J35022_10022007 3300002462 Bacteria 3455
71 Ga0068305_10340049 3300005083 Bacteria 1974
72 Ga0072941_1098282 3300005201 Unclassified 2735
73 Ga0123356_10050668 3300010049 Bacteria 3863
74 Ga0123356_10786589 3300010049 Unclassified 1122
75 Ga0123353_10070834 3300010167 Bacteria 5603
76 Ga0123353_10082078 3300010167 Bacteria 5185
77 Ga0123353_10168411 3300010167 Bacteria 3480
78 Ga0123353_10555558 3300010167 Unclassified 1654
79 Ga0123354_10505070 3300010882 Unclassified 940
80 Ga0466707_318445 3300042601 Bacteria 7383
81 Ga0466713_123020 3300042602 Bacteria 4602
82 Ga0466703_041381 3300042636 Bacteria 5092
83 Ga0466703_212573 3300042636 Unclassified 24947
84 Ga0466704_030863 3300042643 Bacteria 6379
85 Ga0466657_066609 3300042582 Bacteria 1037
86 Ga0466692_086671 3300042591 Bacteria 24337
87 Ga0466693_168255 3300042592 Bacteria 1657
88 Ga0466699_376015 3300042597 Bacteria 1921
89 Ga0466715_008785 3300042616 Bacteria 6392
90 Ga0466715_017340 3300042616 Unclassified 8190
91 Ga0466715_289937 3300042616 Bacteria 2797
92 Ga0466723_073026 3300042618 Bacteria 14257
93 Ga0466728_030504 3300042620 Bacteria 4810
94 Ga0068302_10202099 3300005071 Bacteria 1564
95 Ga0068305_10816682 3300005083 Bacteria 981
96 Ga0123356_10367727 3300010049 Unclassified 1567
97 Ga0123356_10471413 3300010049 Bacteria 1407
98 Ga0123356_10528128 3300010049 Bacteria 1339
99 Ga0123353_10001926 3300010167 Bacteria 25529
100 Ga0123353_10054835 3300010167 Bacteria 6376
101 Ga0123353_10072811 3300010167 Bacteria 5522
102 Ga0123353_10104950 3300010167 Bacteria 4554
103 Ga0123353_10970568 3300010167 Bacteria 1146
104 Ga0123354_10342063 3300010882 Bacteria 1347
105 Ga0466713_016922 3300042602 Bacteria 10455
106 Ga0466717_221152 3300042604 Bacteria 2645
107 Ga0466719_145773 3300042606 Bacteria 13035
108 Ga0466703_311188 3300042636 Bacteria 6085
109 Ga0466704_191562 3300042643 Bacteria 3396
110 Ga0466690_065117 3300042590 Bacteria 1675
111 Ga0466695_145438 3300042595 Bacteria 1263
112 Ga0466695_347507 3300042595 Unclassified 2638
113 Ga0466696_133687 3300042596 Bacteria 3132
114 Ga0466712_183282 3300042614 Bacteria 2393
115 Ga0466718_105901 3300042617 Unclassified 1902
116 Ga0466726_128021 3300042619 Bacteria 20406
117 Ga0466726_467236 3300042619 Bacteria 17281
118 Ga0466729_006415 3300042621 Bacteria 3273
119 JGI24702J35022_10071091 3300002462 Bacteria 1874
120 JGI24702J35022_10135417 3300002462 Bacteria 1370
121 Ga0123357_10152709 3300009784 Unclassified 2796
122 Ga0123356_10704156 3300010049 Bacteria 1179
123 Ga0123353_10002849 3300010167 Bacteria 21619
124 Ga0123353_10047300 3300010167 Bacteria 6841
125 Ga0466707_102414 3300042601 Bacteria 1500
126 Ga0466717_138180 3300042604 Bacteria 1179
127 Ga0466719_037181 3300042606 Unclassified 9924
128 Ga0466734_090304 3300042623 Bacteria 3481
129 Ga0466691_029839 3300042593 Bacteria 7815
130 Ga0466705_349196 3300042612 Bacteria 1240
131 Ga0466711_362867 3300042615 Bacteria 6589
132 Ga0123356_10220326 3300010049 Unclassified 1953
133 Ga0123353_10000194 3300010167 Bacteria 76860
134 Ga0123353_10012040 3300010167 Unclassified 12247
135 Ga0123353_10234986 3300010167 Bacteria 2854
136 Ga0123353_10367339 3300010167 Bacteria 2159
137 Ga0466717_083497 3300042604 Unclassified 1160
138 Ga0466719_054640 3300042606 Unclassified 3595
139 Ga0466719_117043 3300042606 Unclassified 3395
140 Ga0466719_140932 3300042606 Bacteria 13754
141 Ga0466698_153343 3300042610 Bacteria 5401
142 Ga0466698_311653 3300042610 Bacteria 1395
143 Ga0466703_107378 3300042636 Bacteria 2315
144 Ga0466708_113787 3300042652 Bacteria 3168
145 Ga0466690_065051 3300042590 Unclassified 10397
146 Ga0466696_131828 3300042596 Unclassified 11562
147 Ga0466696_293193 3300042596 Unclassified 4342
148 Ga0466699_287212 3300042597 Bacteria 1027

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042652 Ga0466708_085363 Ga0466708_085363_27317_28141 260
2 3300042602 Ga0466713_016922 Ga0466713_016922_271_1104 263
3 3300042602 Ga0466713_123020 Ga0466713_123020_2321_3145 263
4 3300005083 Ga0068305_10340049 Ga0068305_103400492 264
5 3300042636 Ga0466703_212573 Ga0466703_212573_17655_18482 264
6 3300042616 Ga0466715_017340 Ga0466715_017340_4616_5443 265
7 3300010882 Ga0123354_10505070 Ga0123354_105050701 266
8 3300042596 Ga0466696_449841 Ga0466696_449841_4395_5234 268
9 3300042617 Ga0466718_105901 Ga0466718_105901_716_1522 268
10 3300005083 Ga0068305_10816682 Ga0068305_108166821 272
11 3300042590 Ga0466690_288661 Ga0466690_288661_1340_2164 274
12 3300042590 Ga0466690_430421 Ga0466690_430421_423_1247 274
13 3300042593 Ga0466691_150312 Ga0466691_150312_2397_3221 274
14 3300042595 Ga0466695_145438 Ga0466695_145438_355_1179 274
15 3300042597 Ga0466699_287212 Ga0466699_287212_114_938 274
16 3300042601 Ga0466707_102414 Ga0466707_102414_251_1075 274
17 3300042605 Ga0466716_146861 Ga0466716_146861_496_1320 274
18 3300042605 Ga0466716_202439 Ga0466716_202439_727_1551 274
19 3300042605 Ga0466716_264195 Ga0466716_264195_298_1122 274
20 3300042606 Ga0466719_037181 Ga0466719_037181_4950_5774 274
21 3300042606 Ga0466719_316141 Ga0466719_316141_1973_2797 274
22 3300042614 Ga0466712_241033 Ga0466712_241033_790_1614 274
23 3300042616 Ga0466715_264012 Ga0466715_264012_664_1488 274
24 3300042618 Ga0466723_073026 Ga0466723_073026_8110_8934 274
25 3300042618 Ga0466723_164975 Ga0466723_164975_1093_1917 274
26 3300042619 Ga0466726_467236 Ga0466726_467236_12166_12990 274
27 3300042620 Ga0466728_132256 Ga0466728_132256_814_1638 274
28 3300042621 Ga0466729_130384 Ga0466729_130384_3036_3860 274
29 3300042621 Ga0466729_276186 Ga0466729_276186_2207_3031 274
30 3300042623 Ga0466734_090304 Ga0466734_090304_702_1526 274
31 3300042636 Ga0466703_049965 Ga0466703_049965_2194_3018 274
32 3300042636 Ga0466703_107378 Ga0466703_107378_257_1081 274
33 3300042636 Ga0466703_311188 Ga0466703_311188_2852_3676 274
34 3300042643 Ga0466704_030863 Ga0466704_030863_2243_3067 274
35 3300042643 Ga0466704_191562 Ga0466704_191562_665_1489 274
36 3300042655 Ga0466727_078524 Ga0466727_078524_765_1589 274
37 iso_pr_bacteria 2820171952 2820174327 274
38 iso_pr_bacteria 2820180635 2820182880 274
39 iso_pr_bacteria 2820196379 2820198555 274
40 iso_pr_bacteria 2820205024 2820205112 274
41 3300002462 JGI24702J35022_10135417 JGI24702J35022_101354172 275
42 3300005071 Ga0068302_10202099 Ga0068302_102020991 275
43 3300010049 Ga0123356_10050668 Ga0123356_100506681 275
44 3300010049 Ga0123356_10241198 Ga0123356_102411982 275
45 3300010049 Ga0123356_10367727 Ga0123356_103677272 275
46 3300010049 Ga0123356_10471413 Ga0123356_104714132 275
47 3300010167 Ga0123353_10001578 Ga0123353_1000157819 275
48 3300010167 Ga0123353_10004651 Ga0123353_100046515 275
49 3300010167 Ga0123353_10021395 Ga0123353_100213953 275
50 3300010167 Ga0123353_10054835 Ga0123353_100548353 275
51 3300010167 Ga0123353_10104950 Ga0123353_101049501 275
52 3300010167 Ga0123353_10234986 Ga0123353_102349863 275
53 3300010167 Ga0123353_10267686 Ga0123353_102676863 275
54 3300010167 Ga0123353_10282323 Ga0123353_102823232 275
55 3300010167 Ga0123353_10366634 Ga0123353_103666342 275
56 3300042590 Ga0466690_065051 Ga0466690_065051_9240_10067 275
57 3300042596 Ga0466696_131828 Ga0466696_131828_1574_2401 275
58 3300042596 Ga0466696_133687 Ga0466696_133687_1707_2534 275
59 3300042604 Ga0466717_221152 Ga0466717_221152_468_1295 275
60 3300042606 Ga0466719_054640 Ga0466719_054640_46_873 275
61 3300042606 Ga0466719_145773 Ga0466719_145773_11315_12142 275
62 3300042616 Ga0466715_008785 Ga0466715_008785_5223_6050 275
63 3300042621 Ga0466729_307592 Ga0466729_307592_185_1012 275
64 3300042643 Ga0466704_305415 Ga0466704_305415_607_1434 275
65 iso_pr_bacteria 2820185449 2820187249 275
66 iso_pr_bacteria 2820185449 2820188060 275
67 iso_pr_bacteria 2820201435 2820202594 275
68 3300005201 Ga0072941_1060136 Ga0072941_10601362 276
69 3300005201 Ga0072941_1098282 Ga0072941_10982822 276
70 3300010049 Ga0123356_10456844 Ga0123356_104568442 276
71 3300010167 Ga0123353_10023305 Ga0123353_100233055 276
72 3300010167 Ga0123353_10070834 Ga0123353_100708344 276
73 3300010167 Ga0123353_10228363 Ga0123353_102283632 276
74 3300010167 Ga0123353_10555558 Ga0123353_105555582 276
75 3300042590 Ga0466690_065117 Ga0466690_065117_640_1470 276
76 3300042591 Ga0466692_086671 Ga0466692_086671_6391_7221 276
77 3300042596 Ga0466696_105433 Ga0466696_105433_2345_3175 276
78 3300042596 Ga0466696_293193 Ga0466696_293193_1785_2615 276
79 3300042597 Ga0466699_376015 Ga0466699_376015_280_1110 276
80 3300042604 Ga0466717_138180 Ga0466717_138180_248_1078 276
81 3300042605 Ga0466716_084810 Ga0466716_084810_8816_9646 276
82 3300042606 Ga0466719_056242 Ga0466719_056242_660_1490 276
83 3300042606 Ga0466719_117043 Ga0466719_117043_2037_2867 276
84 3300042610 Ga0466698_311653 Ga0466698_311653_21_851 276
85 3300042612 Ga0466705_349196 Ga0466705_349196_356_1186 276
86 3300042615 Ga0466711_362867 Ga0466711_362867_3884_4714 276
87 3300042615 Ga0466711_484593 Ga0466711_484593_144_974 276
88 3300042616 Ga0466715_098206 Ga0466715_098206_452_1282 276
89 3300042616 Ga0466715_114094 Ga0466715_114094_16970_17800 276
90 3300042616 Ga0466715_431608 Ga0466715_431608_494_1324 276
91 3300042616 Ga0466715_566576 Ga0466715_566576_5745_6575 276
92 3300042619 Ga0466726_128021 Ga0466726_128021_4975_5805 276
93 3300042620 Ga0466728_030504 Ga0466728_030504_3499_4329 276
94 3300042621 Ga0466729_239237 Ga0466729_239237_364_1194 276
95 3300042621 Ga0466729_299381 Ga0466729_299381_9491_10321 276
96 3300042643 Ga0466704_303430 Ga0466704_303430_315_1145 276
97 3300042652 Ga0466708_113787 Ga0466708_113787_314_1144 276
98 iso_pr_bacteria 2820171952 2820172364 276
99 iso_pr_bacteria 2820178484 2820180572 276
100 iso_pr_bacteria 2820180635 2820181590 276
101 3300002450 JGI24695J34938_10036292 JGI24695J34938_100362922 277
102 3300002462 JGI24702J35022_10041974 JGI24702J35022_100419741 277
103 3300002462 JGI24702J35022_10071091 JGI24702J35022_100710912 277
104 3300009784 Ga0123357_10152709 Ga0123357_101527092 277
105 3300010049 Ga0123356_10177623 Ga0123356_101776232 277
106 3300010049 Ga0123356_10220326 Ga0123356_102203262 277
107 3300010049 Ga0123356_10327476 Ga0123356_103274762 277
108 3300010049 Ga0123356_10786589 Ga0123356_107865891 277
109 3300010049 Ga0123356_11175594 Ga0123356_111755941 277
110 3300010167 Ga0123353_10000194 Ga0123353_100001942 277
111 3300010167 Ga0123353_10012040 Ga0123353_100120408 277
112 3300010167 Ga0123353_10082078 Ga0123353_100820783 277
113 3300010167 Ga0123353_10172699 Ga0123353_101726992 277
114 3300010167 Ga0123353_10177259 Ga0123353_101772593 277
115 3300010167 Ga0123353_10304929 Ga0123353_103049292 277
116 3300010167 Ga0123353_10785781 Ga0123353_107857812 277
117 3300042582 Ga0466657_066609 Ga0466657_066609_124_957 277
118 3300042592 Ga0466693_168255 Ga0466693_168255_286_1119 277
119 3300042592 Ga0466693_239100 Ga0466693_239100_34_867 277
120 3300042595 Ga0466695_135903 Ga0466695_135903_147_980 277
121 3300042604 Ga0466717_083497 Ga0466717_083497_138_971 277
122 3300042605 Ga0466716_352660 Ga0466716_352660_93_926 277
123 3300042614 Ga0466712_183282 Ga0466712_183282_168_1001 277
124 3300042623 Ga0466734_063431 Ga0466734_063431_4847_5680 277
125 iso_pr_bacteria 2820209022 2820209125 277
126 iso_pr_bacteria 2820211246 2820213287 277
127 3300002462 JGI24702J35022_10018683 JGI24702J35022_100186834 278
128 3300002462 JGI24702J35022_10022007 JGI24702J35022_100220073 278
129 3300010167 Ga0123353_10047300 Ga0123353_100473005 278
130 3300010167 Ga0123353_10338548 Ga0123353_103385482 278
131 3300010167 Ga0123353_10367339 Ga0123353_103673392 278
132 3300010167 Ga0123353_10970568 Ga0123353_109705682 278
133 3300010882 Ga0123354_10342063 Ga0123354_103420632 278
134 3300042592 Ga0466693_190492 Ga0466693_190492_1326_2162 278
135 3300042593 Ga0466691_029839 Ga0466691_029839_495_1331 278
136 3300042606 Ga0466719_140932 Ga0466719_140932_6642_7478 278
137 3300042617 Ga0466718_093128 Ga0466718_093128_1063_1899 278
138 3300042620 Ga0466728_429110 Ga0466728_429110_152_988 278
139 3300042621 Ga0466729_006415 Ga0466729_006415_2019_2855 278
140 3300042622 Ga0466731_404128 Ga0466731_404128_137_973 278
141 iso_pr_bacteria 2820185449 2820188707 278
142 3300010167 Ga0123353_10002849 Ga0123353_100028496 279
143 3300010167 Ga0123353_10005726 Ga0123353_1000572610 279
144 3300010167 Ga0123353_10072811 Ga0123353_100728114 279
145 3300010167 Ga0123353_10168411 Ga0123353_101684112 279
146 3300042616 Ga0466715_289937 Ga0466715_289937_540_1382 280
147 3300010049 Ga0123356_10704156 Ga0123356_107041562 281
148 3300042610 Ga0466698_153343 Ga0466698_153343_4354_5199 281
149 3300042612 Ga0466705_205692 Ga0466705_205692_4871_5725 284
150 3300042621 Ga0466729_133179 Ga0466729_133179_234_1091 285
151 3300042643 Ga0466704_138188 Ga0466704_138188_2575_3432 285
152 2225789004 2227481329 2227942138 287
153 3300042601 Ga0466707_318445 Ga0466707_318445_3308_4186 292
154 3300010049 Ga0123356_10528128 Ga0123356_105281282 296
155 3300042595 Ga0466695_347507 Ga0466695_347507_1018_1914 298
156 3300042636 Ga0466703_240665 Ga0466703_240665_478_1374 298
157 3300042636 Ga0466703_041381 Ga0466703_041381_234_1205 304
158 3300010167 Ga0123353_10314619 Ga0123353_103146191 305
159 3300042615 Ga0466711_081059 Ga0466711_081059_239_1258 309
160 3300010882 Ga0123354_10366767 Ga0123354_103667672 312
161 3300010167 Ga0123353_10001926 Ga0123353_100019264 319

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01261 AP_endonuc_2 Xylose isomerase-like TIM barrel 67 315 0.81

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.84 0.9 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.