Protein Family IF02982

Metagenome Metatranscriptome Isolate
128 Members
42 Samples
115 Scaffolds
171.79 Avg Length

🧬 Representative Sequence

ID
3300010049|Ga0123356_11756887|Ga0123356_117568872
Length
196 aa
Sequence
MKAVINSIFSLIAETLATPVRRYILLIVILALVALSEFLALGLARRTFVFYTVNDGVIVVEDRMLKHFSSWNSRPDGFSRIFAGTKYREGDVIRYIEETLLGPVAPNLLPLFPRETRLKSLLFQDGVVYANLSESAAIPPVEGGRTIDNFQTLNAGVLRNFSYVKEVRFFIEGNAIYVDGFLDEAAEDSQVFSEI*

📊 Sample Types

Isolate 10.2%
Metagenome 88.3%
MAG 0.0%
Metatranscriptome 1.6%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 55.3%
Unclassified 36.8%
Kalotermitidae 5.3%
Rhinotermitidae 2.6%

🌳 Taxonomy

Archaea 0
Bacteria 116
Eukaryota 0
Viruses 0
Unclassified 12

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
2 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
3 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
4 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
5 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
6 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
7 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
8 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
9 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
10 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
11 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
12 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
13 3300021239 Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA Metatranscriptome
14 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
15 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
16 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
17 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
18 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
19 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
20 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
21 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
22 2781125647 Treponema sp. Co191P3bin16 Isolate Unclassified
23 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
24 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
25 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
26 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
27 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
28 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
29 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
30 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
31 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
32 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
33 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
34 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
35 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
36 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
37 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
38 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
39 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
40 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
41 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
42 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466707_028573 3300042601 Bacteria 2852
2 Ga0123356_10008552 3300010049 Bacteria 10165
3 Ga0123356_10238914 3300010049 Bacteria 1886
4 Ga0466712_195529 3300042614 Bacteria 7392
5 AustNasuHG_c1041078 3300000089 Bacteria 1120
6 JGI24698J34947_10001180 3300002449 Bacteria 13623
7 JGI24695J34938_10001930 3300002450 Bacteria 16707
8 JGI24695J34938_10009027 3300002450 Bacteria 5595
9 Ga0072941_1006754 3300005201 Bacteria 15785
10 Ga0072941_1041645 3300005201 Bacteria 11687
11 Ga0072941_1200776 3300005201 Bacteria 881
12 Ga0466699_029761 3300042597 Bacteria 3010
13 Ga0466731_374087 3300042622 Bacteria 5122
14 Ga0466705_258564 3300042612 Bacteria 16922
15 Ga0123356_10000062 3300010049 Bacteria 112695
16 Ga0123356_10044602 3300010049 Bacteria 4127
17 Ga0123356_11756887 3300010049 Bacteria 770
18 Ga0466712_057394 3300042614 Bacteria 3333
19 JGI24698J34947_10004890 3300002449 Bacteria 7341
20 JGI24698J34947_10010860 3300002449 Bacteria 4996
21 JGI24698J34947_10029743 3300002449 Bacteria 2885
22 JGI24698J34947_10088526 3300002449 Bacteria 1428
23 JGI24695J34938_10002882 3300002450 Bacteria 12527
24 JGI24695J34938_10265888 3300002450 Bacteria 732
25 Ga0072941_1030657 3300005201 Bacteria 1920
26 Ga0466699_049106 3300042597 Unclassified 2644
27 Ga0466720_032922 3300042607 Bacteria 3234
28 Ga0466721_239644 3300042608 Bacteria 18017
29 Ga0123356_10037347 3300010049 Bacteria 4533
30 Ga0466712_064013 3300042614 Bacteria 1067
31 Ga0466718_067061 3300042617 Bacteria 1006
32 JGI24698J34947_10010032 3300002449 Bacteria 5190
33 JGI24698J34947_10034737 3300002449 Unclassified 2635
34 JGI24695J34938_10001296 3300002450 Bacteria 21885
35 JGI24695J34938_10022906 3300002450 Bacteria 3021
36 Ga0072941_1008058 3300005201 Bacteria 19835
37 Ga0072941_1016829 3300005201 Bacteria 15253
38 Ga0223677_1011760 3300021239 Bacteria 751
39 Ga0223677_1020977 3300021239 Bacteria 613
40 Ga0466731_144769 3300042622 Bacteria 1193
41 Ga0466721_261399 3300042608 Bacteria 2701
42 Ga0466698_319727 3300042610 Bacteria 1143
43 Ga0123356_10124994 3300010049 Bacteria 2509
44 Ga0466712_011665 3300042614 Bacteria 9234
45 Ga0466712_097971 3300042614 Bacteria 5188
46 Ga0466712_122176 3300042614 Bacteria 31114
47 Ga0466718_137543 3300042617 Bacteria 4469
48 Ga0466718_151499 3300042617 Bacteria 3991
49 2230969623 2228664004 Bacteria 9223
50 JGI24698J34947_10162972 3300002449 Bacteria 911
51 JGI24695J34938_10013369 3300002450 Bacteria 4313
52 JGI24695J34938_10042326 3300002450 Bacteria 2039
53 JGI24700J35501_10930487 3300002508 Bacteria 14650
54 Ga0072941_1008961 3300005201 Bacteria 13391
55 Ga0072941_1041668 3300005201 Bacteria 4077
56 Ga0264413_103096 3300024493 Bacteria 4638
57 Ga0466731_143336 3300042622 Bacteria 3549
58 Ga0466722_015336 3300042609 Bacteria 2098
59 Ga0466712_126889 3300042614 Unclassified 1835
60 Ga0466712_165953 3300042614 Bacteria 35107
61 Ga0466712_168329 3300042614 Bacteria 1282
62 Ga0466712_251312 3300042614 Bacteria 5208
63 Ga0072941_1004733 3300005201 Bacteria 6815
64 Ga0072941_1030658 3300005201 Bacteria 748
65 Ga0264413_118506 3300024493 Bacteria 8960
66 Ga0415639_062558 3300038395 Bacteria 2436
67 Ga0466731_399253 3300042622 Bacteria 2159
68 Ga0466720_237158 3300042607 Bacteria 5891
69 Ga0123356_10264572 3300010049 Bacteria 1806
70 Ga0466712_005232 3300042614 Bacteria 2359
71 FAAS_10482465 3300001880 Unclassified 581
72 JGI24698J34947_10006187 3300002449 Bacteria 6574
73 JGI24698J34947_10032178 3300002449 Unclassified 2755
74 JGI24698J34947_10074927 3300002449 Unclassified 1611
75 JGI24698J34947_10076582 3300002449 Unclassified 1585
76 JGI24695J34938_10010409 3300002450 Unclassified 5092
77 JGI24697J35500_11255381 3300002507 Bacteria 2702
78 Ga0072941_1004185 3300005201 Bacteria 50030
79 Ga0072941_1028887 3300005201 Bacteria 19122
80 Ga0415639_041260 3300038395 Bacteria 5644
81 Ga0466693_021018 3300042592 Bacteria 19387
82 Ga0466694_151508 3300042594 Bacteria 7675
83 Ga0466702_028023 3300042635 Bacteria 1932
84 Ga0466702_171802 3300042635 Unclassified 23782
85 Ga0466722_006711 3300042609 Bacteria 7764
86 Ga0123356_10000204 3300010049 Bacteria 68773
87 Ga0466718_008561 3300042617 Bacteria 19760
88 Ga0466718_066729 3300042617 Bacteria 5546
89 Ga0466718_117275 3300042617 Bacteria 17730
90 JGI24698J34947_10014710 3300002449 Bacteria 4263
91 JGI24695J34938_10000016 3300002450 Bacteria 116336
92 JGI24695J34938_10003627 3300002450 Bacteria 10606
93 Ga0072940_1031156 3300005200 Bacteria 3980
94 Ga0466694_139847 3300042594 Bacteria 19575
95 Ga0466699_342703 3300042597 Bacteria 1200
96 Ga0466699_377722 3300042597 Bacteria 2983
97 Ga0466731_163375 3300042622 Bacteria 5022
98 Ga0466698_457374 3300042610 Bacteria 1446
99 Ga0123356_10014101 3300010049 Bacteria 7685
100 Ga0123353_10027100 3300010167 Bacteria 8774
101 Ga0123353_10792434 3300010167 Bacteria 1310
102 AustNasuHG_c1002894 3300000089 Bacteria 6199
103 AustNasuHG_c1037207 3300000089 Bacteria 1248
104 JGI24698J34947_10001101 3300002449 Bacteria 13934
105 JGI24698J34947_10017245 3300002449 Bacteria 3916
106 JGI24698J34947_10023318 3300002449 Bacteria 3311
107 JGI24698J34947_10056598 3300002449 Bacteria 1949
108 JGI24695J34938_10004823 3300002450 Unclassified 8671
109 JGI24699J35502_10715085 3300002509 Unclassified 781
110 JGI24699J35502_11101131 3300002509 Unclassified 2366
111 Ga0264413_137049 3300024493 Bacteria 2430
112 Ga0415639_056851 3300038395 Bacteria 3855
113 Ga0466694_103048 3300042594 Bacteria 3068
114 Ga0466702_158075 3300042635 Bacteria 1840
115 Ga0466704_047567 3300042643 Bacteria 9131

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF10646 Germane Sporulation and spore germination 92 175 0.76

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.