Protein Family IF02974
Metagenome
Isolate
139
Members
36
Samples
136
Scaffolds
129.84
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_11384235|Ga0123356_113842352
- Length
- 121 aa
- Sequence
- MKIPVEDIIVKKRIRREFNDFGALAESMKCYGQISPILISKKNVLIAGFRRLEAAKRLGWPTIEAVISESSTELDRLELEVEENAAEASRKIYRLRNPGFFRRILDTIIRFFKKLLKKEE*
Sample Types
Isolate
2.2%
Metagenome
97.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
36.1%
Termitidae
36.1%
Unclassified
11.1%
Rhinotermitidae
8.3%
Termopsidae
8.3%
Taxonomy
Archaea
1
Bacteria
129
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 11 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 17 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 18 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 28 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 29 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466691_088308 | 3300042593 | Bacteria | 8235 |
| 2 | Ga0466691_146930 | 3300042593 | Bacteria | 22116 |
| 3 | Ga0466699_353050 | 3300042597 | Bacteria | 1312 |
| 4 | Ga0466711_054384 | 3300042615 | Bacteria | 10745 |
| 5 | Ga0466715_003753 | 3300042616 | Bacteria | 8888 |
| 6 | Ga0466715_292004 | 3300042616 | Bacteria | 18909 |
| 7 | Ga0466728_385803 | 3300042620 | Bacteria | 2817 |
| 8 | Ga0466707_237059 | 3300042601 | Bacteria | 5642 |
| 9 | Ga0466716_148744 | 3300042605 | Bacteria | 9322 |
| 10 | Ga0466735_003801 | 3300042624 | Bacteria | 14568 |
| 11 | Ga0466704_169450 | 3300042643 | Bacteria | 14153 |
| 12 | Ga0466709_118042 | 3300042648 | Bacteria | 3277 |
| 13 | Ga0466708_194028 | 3300042652 | Bacteria | 4637 |
| 14 | Ga0466708_431352 | 3300042652 | Bacteria | 1964 |
| 15 | Ga0123357_10010473 | 3300009784 | Bacteria | 11798 |
| 16 | Ga0123357_10551201 | 3300009784 | Bacteria | 919 |
| 17 | Ga0123353_10391090 | 3300010167 | Bacteria | 2074 |
| 18 | Ga0123353_10432167 | 3300010167 | Bacteria | 1946 |
| 19 | Ga0466705_043001 | 3300042612 | Bacteria | 12081 |
| 20 | JGI24696J40584_12492025 | 3300002834 | Bacteria | 595 |
| 21 | Ga0466699_185800 | 3300042597 | Bacteria | 1544 |
| 22 | Ga0466699_426293 | 3300042597 | Bacteria | 2328 |
| 23 | Ga0466715_099489 | 3300042616 | Bacteria | 12002 |
| 24 | Ga0466723_135403 | 3300042618 | Bacteria | 1049 |
| 25 | Ga0466723_205377 | 3300042618 | Bacteria | 6652 |
| 26 | Ga0466728_393530 | 3300042620 | Bacteria | 1947 |
| 27 | Ga0466719_172348 | 3300042606 | Bacteria | 4384 |
| 28 | Ga0466703_363136 | 3300042636 | Bacteria | 3920 |
| 29 | Ga0466708_340404 | 3300042652 | Bacteria | 5523 |
| 30 | Ga0466708_441427 | 3300042652 | Unclassified | 1813 |
| 31 | Ga0123353_10901094 | 3300010167 | Bacteria | 1204 |
| 32 | Ga0466699_050802 | 3300042597 | Bacteria | 20965 |
| 33 | Ga0466699_442259 | 3300042597 | Bacteria | 1930 |
| 34 | Ga0466711_090217 | 3300042615 | Bacteria | 1369 |
| 35 | Ga0466715_218232 | 3300042616 | Bacteria | 1980 |
| 36 | Ga0466715_228315 | 3300042616 | Bacteria | 8054 |
| 37 | Ga0466715_232479 | 3300042616 | Bacteria | 11747 |
| 38 | Ga0466715_429932 | 3300042616 | Bacteria | 6113 |
| 39 | Ga0466701_069979 | 3300042598 | Bacteria | 1002 |
| 40 | Ga0466700_437108 | 3300042600 | Bacteria | 1449 |
| 41 | Ga0466707_272421 | 3300042601 | Bacteria | 1396 |
| 42 | Ga0466719_218211 | 3300042606 | Bacteria | 2587 |
| 43 | Ga0466735_223797 | 3300042624 | Bacteria | 1430 |
| 44 | Ga0466703_229645 | 3300042636 | Bacteria | 4240 |
| 45 | Ga0466704_136177 | 3300042643 | Bacteria | 10104 |
| 46 | Ga0466709_011036 | 3300042648 | Bacteria | 2786 |
| 47 | Ga0466708_141272 | 3300042652 | Bacteria | 1981 |
| 48 | Ga0466727_317891 | 3300042655 | Bacteria | 1075 |
| 49 | Ga0123353_10307599 | 3300010167 | Bacteria | 2415 |
| 50 | Ga0123353_11212934 | 3300010167 | Bacteria | 989 |
| 51 | Ga0123353_11457688 | 3300010167 | Unclassified | 875 |
| 52 | Ga0466732_263219 | 3300042656 | Bacteria | 1050 |
| 53 | Ga0466693_178116 | 3300042592 | Bacteria | 1100 |
| 54 | Ga0466694_226894 | 3300042594 | Bacteria | 33377 |
| 55 | Ga0466705_400326 | 3300042612 | Bacteria | 5094 |
| 56 | Ga0466715_019728 | 3300042616 | Bacteria | 1700 |
| 57 | Ga0466715_188638 | 3300042616 | Bacteria | 1277 |
| 58 | Ga0466723_072431 | 3300042618 | Bacteria | 5587 |
| 59 | Ga0466719_065528 | 3300042606 | Bacteria | 25048 |
| 60 | Ga0466735_060842 | 3300042624 | Bacteria | 2267 |
| 61 | Ga0466708_015016 | 3300042652 | Bacteria | 30150 |
| 62 | Ga0466708_017222 | 3300042652 | Bacteria | 1152 |
| 63 | Ga0466708_139593 | 3300042652 | Bacteria | 1153 |
| 64 | Ga0466727_241303 | 3300042655 | Bacteria | 7263 |
| 65 | Ga0466727_301109 | 3300042655 | Bacteria | 1316 |
| 66 | Ga0123353_11197654 | 3300010167 | Unclassified | 997 |
| 67 | JGI24702J35022_10050728 | 3300002462 | Unclassified | 2211 |
| 68 | JGI24702J35022_10195509 | 3300002462 | Bacteria | 1155 |
| 69 | Ga0466692_115244 | 3300042591 | Bacteria | 40575 |
| 70 | Ga0466711_004939 | 3300042615 | Archaea | 2701 |
| 71 | Ga0466711_051123 | 3300042615 | Bacteria | 3573 |
| 72 | Ga0466723_010118 | 3300042618 | Bacteria | 2879 |
| 73 | Ga0466723_064483 | 3300042618 | Bacteria | 9657 |
| 74 | Ga0466723_078096 | 3300042618 | Bacteria | 14560 |
| 75 | Ga0466723_338706 | 3300042618 | Bacteria | 1633 |
| 76 | Ga0466729_060005 | 3300042621 | Bacteria | 1137 |
| 77 | Ga0466735_012823 | 3300042624 | Bacteria | 5868 |
| 78 | Ga0466735_084834 | 3300042624 | Bacteria | 1162 |
| 79 | Ga0466704_097504 | 3300042643 | Bacteria | 3817 |
| 80 | Ga0466704_307336 | 3300042643 | Bacteria | 8316 |
| 81 | Ga0466709_232945 | 3300042648 | Bacteria | 2887 |
| 82 | Ga0466709_319571 | 3300042648 | Bacteria | 6198 |
| 83 | Ga0466709_350420 | 3300042648 | Unclassified | 2377 |
| 84 | Ga0466727_300274 | 3300042655 | Bacteria | 1283 |
| 85 | Ga0123356_11384235 | 3300010049 | Bacteria | 864 |
| 86 | Ga0123353_11381372 | 3300010167 | Unclassified | 907 |
| 87 | Ga0466705_122960 | 3300042612 | Bacteria | 4013 |
| 88 | Ga0466705_311856 | 3300042612 | Bacteria | 3587 |
| 89 | JGI24698J34947_10105041 | 3300002449 | Bacteria | 1260 |
| 90 | JGI24702J35022_10619976 | 3300002462 | Bacteria | 670 |
| 91 | Ga0466690_019427 | 3300042590 | Unclassified | 1531 |
| 92 | Ga0466715_101884 | 3300042616 | Bacteria | 31508 |
| 93 | Ga0466707_100014 | 3300042601 | Bacteria | 1072 |
| 94 | Ga0466716_157573 | 3300042605 | Bacteria | 2695 |
| 95 | Ga0466719_495178 | 3300042606 | Bacteria | 1005 |
| 96 | Ga0466735_032715 | 3300042624 | Bacteria | 1375 |
| 97 | Ga0466704_568444 | 3300042643 | Bacteria | 2373 |
| 98 | Ga0466708_450487 | 3300042652 | Bacteria | 1488 |
| 99 | Ga0123353_11672478 | 3300010167 | Bacteria | 799 |
| 100 | Ga0123353_13206756 | 3300010167 | Bacteria | 524 |
| 101 | JGI24698J34947_10026787 | 3300002449 | Bacteria | 3061 |
| 102 | Ga0466690_387926 | 3300042590 | Bacteria | 2741 |
| 103 | Ga0466699_319411 | 3300042597 | Bacteria | 1453 |
| 104 | Ga0466705_451912 | 3300042612 | Bacteria | 10192 |
| 105 | Ga0466715_263100 | 3300042616 | Bacteria | 9603 |
| 106 | Ga0466715_461767 | 3300042616 | Bacteria | 5417 |
| 107 | Ga0466715_484511 | 3300042616 | Bacteria | 3768 |
| 108 | Ga0466718_118514 | 3300042617 | Bacteria | 9397 |
| 109 | Ga0466707_182081 | 3300042601 | Bacteria | 9680 |
| 110 | Ga0466716_340392 | 3300042605 | Bacteria | 2267 |
| 111 | Ga0466719_143981 | 3300042606 | Bacteria | 9263 |
| 112 | Ga0466722_128057 | 3300042609 | Bacteria | 15887 |
| 113 | Ga0466729_276950 | 3300042621 | Bacteria | 1955 |
| 114 | Ga0466704_068553 | 3300042643 | Bacteria | 12921 |
| 115 | Ga0466704_188110 | 3300042643 | Bacteria | 2887 |
| 116 | Ga0466704_565889 | 3300042643 | Bacteria | 8632 |
| 117 | Ga0466709_308001 | 3300042648 | Bacteria | 15552 |
| 118 | Ga0466705_053709 | 3300042612 | Bacteria | 1082 |
| 119 | Ga0466690_006618 | 3300042590 | Bacteria | 1628 |
| 120 | Ga0466691_009780 | 3300042593 | Bacteria | 1121 |
| 121 | Ga0466699_325792 | 3300042597 | Bacteria | 1012 |
| 122 | Ga0466711_075917 | 3300042615 | Bacteria | 10634 |
| 123 | Ga0466715_044199 | 3300042616 | Bacteria | 1592 |
| 124 | Ga0466715_369046 | 3300042616 | Bacteria | 3721 |
| 125 | Ga0466715_522094 | 3300042616 | Bacteria | 2654 |
| 126 | Ga0466718_084563 | 3300042617 | Bacteria | 2104 |
| 127 | Ga0466723_010824 | 3300042618 | Bacteria | 4721 |
| 128 | Ga0466723_048447 | 3300042618 | Bacteria | 3934 |
| 129 | Ga0466726_243891 | 3300042619 | Bacteria | 1212 |
| 130 | Ga0466729_187976 | 3300042621 | Unclassified | 1792 |
| 131 | Ga0466719_018943 | 3300042606 | Bacteria | 1284 |
| 132 | Ga0466703_301095 | 3300042636 | Bacteria | 13764 |
| 133 | Ga0466704_105636 | 3300042643 | Bacteria | 29340 |
| 134 | Ga0466727_132721 | 3300042655 | Bacteria | 1935 |
| 135 | Ga0123356_12716542 | 3300010049 | Unclassified | 620 |
| 136 | Ga0123353_10696134 | 3300010167 | Bacteria | 1428 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02195 | ParBc | ParB/Sulfiredoxin domain | 2 | 84 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.