Protein Family IF02648
Metagenome
Isolate
181
Members
41
Samples
180
Scaffolds
330.96
Avg Length
Representative Sequence
- ID
- 3300010049|Ga0123356_10002040|Ga0123356_1000204016
- Length
- 376 aa
- Sequence
- MECFFEWYAKFYGYKVGLIALKWIRNLKCIFDKQASSQGNNLRETVVTMEQLAESHFKLLVSMAVGLVVLVGVIAVLIFFVAVKGAEQTMVPEVRGKDLTEALLELQAKELYPRIQLRYSQSSREKGQILEQDPRAGSIVKAGRQVRLVVSQGVMLNRVENYVGRYINDVRMDLQTFIASAGSPLLVLKEPLMYDFSAESPGTILRQKPEPGTDISGPVSLEFVVSRGPENTLMTVPQLAGLLLPAALEQLGRTDIVFEFFLREIREGERGEMVVYQEPPAGTSVTSNSIVTLVVNAPAQLGDNEVFKLFSYTIPRNPYPLPVRLEALLPSGERIRVIGIDYPGGKFTVPYRLPVGSILILSMMNREIYRETVRY*
Sample Types
Isolate
0.6%
Metagenome
99.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
48.7%
Kalotermitidae
33.3%
Termopsidae
7.7%
Rhinotermitidae
5.1%
Unclassified
5.1%
Taxonomy
Archaea
1
Bacteria
176
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 9 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 10 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 14 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 15 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 21 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 24 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 25 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 26 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 29 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 2228664004 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA | Metagenome | Termitidae |
| 36 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 37 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 38 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 39 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_113668 | 3300024493 | Bacteria | 13305 |
| 2 | Ga0466694_333017 | 3300042594 | Bacteria | 9653 |
| 3 | Ga0466699_420987 | 3300042597 | Bacteria | 4811 |
| 4 | JGI24698J34947_10002531 | 3300002449 | Bacteria | 9862 |
| 5 | JGI24698J34947_10012323 | 3300002449 | Bacteria | 4686 |
| 6 | JGI24695J34938_10005404 | 3300002450 | Bacteria | 7979 |
| 7 | Ga0072941_1014408 | 3300005201 | Bacteria | 13384 |
| 8 | Ga0466712_008289 | 3300042614 | Bacteria | 3001 |
| 9 | Ga0466712_187252 | 3300042614 | Bacteria | 1788 |
| 10 | Ga0466715_133299 | 3300042616 | Bacteria | 4597 |
| 11 | Ga0466718_011064 | 3300042617 | Bacteria | 26269 |
| 12 | Ga0466718_129403 | 3300042617 | Bacteria | 6886 |
| 13 | Ga0466718_143186 | 3300042617 | Bacteria | 1291 |
| 14 | Ga0466716_164561 | 3300042605 | Bacteria | 8480 |
| 15 | Ga0466716_371982 | 3300042605 | Bacteria | 2332 |
| 16 | Ga0123353_10022188 | 3300010167 | Bacteria | 9560 |
| 17 | Ga0466699_069552 | 3300042597 | Bacteria | 2132 |
| 18 | Ga0466699_143168 | 3300042597 | Bacteria | 5869 |
| 19 | Ga0466699_210403 | 3300042597 | Bacteria | 9117 |
| 20 | Ga0466699_331651 | 3300042597 | Bacteria | 2729 |
| 21 | JGI24698J34947_10029901 | 3300002449 | Bacteria | 2875 |
| 22 | JGI24699J35502_11133970 | 3300002509 | Bacteria | 21986 |
| 23 | Ga0072941_1001475 | 3300005201 | Bacteria | 8505 |
| 24 | Ga0466727_209892 | 3300042655 | Bacteria | 1189 |
| 25 | Ga0466712_003200 | 3300042614 | Bacteria | 27121 |
| 26 | Ga0466712_045972 | 3300042614 | Bacteria | 9356 |
| 27 | Ga0466712_093655 | 3300042614 | Bacteria | 3396 |
| 28 | Ga0466712_281667 | 3300042614 | Bacteria | 12480 |
| 29 | Ga0466715_466067 | 3300042616 | Bacteria | 4736 |
| 30 | Ga0466723_088505 | 3300042618 | Bacteria | 4146 |
| 31 | Ga0466726_100519 | 3300042619 | Bacteria | 10669 |
| 32 | Ga0466728_070889 | 3300042620 | Bacteria | 2622 |
| 33 | Ga0466722_157352 | 3300042609 | Bacteria | 3033 |
| 34 | Ga0123356_10001687 | 3300010049 | Bacteria | 24179 |
| 35 | Ga0123356_10136623 | 3300010049 | Bacteria | 2411 |
| 36 | Ga0466705_197675 | 3300042612 | Bacteria | 7780 |
| 37 | Ga0466732_169438 | 3300042656 | Bacteria | 8760 |
| 38 | Ga0264413_109565 | 3300024493 | Bacteria | 11496 |
| 39 | Ga0264413_113395 | 3300024493 | Unclassified | 11167 |
| 40 | Ga0466693_293912 | 3300042592 | Bacteria | 55262 |
| 41 | Ga0466694_003456 | 3300042594 | Bacteria | 20803 |
| 42 | Ga0466694_251341 | 3300042594 | Bacteria | 19435 |
| 43 | Ga0466699_121947 | 3300042597 | Bacteria | 2490 |
| 44 | Ga0466699_130586 | 3300042597 | Bacteria | 14073 |
| 45 | Ga0466699_147966 | 3300042597 | Bacteria | 13012 |
| 46 | JGI24698J34947_10001666 | 3300002449 | Bacteria | 11857 |
| 47 | JGI24698J34947_10007406 | 3300002449 | Bacteria | 6034 |
| 48 | JGI24698J34947_10048594 | 3300002449 | Bacteria | 2148 |
| 49 | JGI24695J34938_10038314 | 3300002450 | Bacteria | 2172 |
| 50 | Ga0466735_056124 | 3300042624 | Bacteria | 19681 |
| 51 | Ga0466702_397819 | 3300042635 | Bacteria | 6214 |
| 52 | Ga0466712_070916 | 3300042614 | Bacteria | 20641 |
| 53 | Ga0466712_217249 | 3300042614 | Bacteria | 27211 |
| 54 | Ga0466711_056003 | 3300042615 | Bacteria | 26561 |
| 55 | Ga0466711_080435 | 3300042615 | Bacteria | 15828 |
| 56 | Ga0466718_023816 | 3300042617 | Bacteria | 1516 |
| 57 | Ga0466718_068555 | 3300042617 | Bacteria | 2844 |
| 58 | Ga0466728_106856 | 3300042620 | Bacteria | 4066 |
| 59 | Ga0466700_193849 | 3300042600 | Bacteria | 35866 |
| 60 | Ga0466700_306192 | 3300042600 | Bacteria | 1883 |
| 61 | Ga0466719_124221 | 3300042606 | Bacteria | 6285 |
| 62 | Ga0466719_297251 | 3300042606 | Bacteria | 8240 |
| 63 | Ga0466720_192784 | 3300042607 | Bacteria | 2506 |
| 64 | Ga0264413_121503 | 3300024493 | Bacteria | 4129 |
| 65 | Ga0415639_052413 | 3300038395 | Bacteria | 5568 |
| 66 | Ga0466692_067795 | 3300042591 | Bacteria | 3741 |
| 67 | Ga0466692_072476 | 3300042591 | Bacteria | 16646 |
| 68 | Ga0466691_066370 | 3300042593 | Bacteria | 2027 |
| 69 | Ga0466694_005539 | 3300042594 | Bacteria | 2172 |
| 70 | Ga0466694_212057 | 3300042594 | Bacteria | 2743 |
| 71 | Ga0466699_048393 | 3300042597 | Bacteria | 18418 |
| 72 | Ga0466699_440887 | 3300042597 | Bacteria | 6318 |
| 73 | 2230969605 | 2228664004 | Bacteria | 12738 |
| 74 | JGI24698J34947_10003440 | 3300002449 | Bacteria | 8585 |
| 75 | JGI24698J34947_10027764 | 3300002449 | Unclassified | 3002 |
| 76 | JGI24698J34947_10028438 | 3300002449 | Bacteria | 2959 |
| 77 | Ga0466735_017006 | 3300042624 | Bacteria | 2185 |
| 78 | Ga0466702_113325 | 3300042635 | Bacteria | 20618 |
| 79 | Ga0466704_372461 | 3300042643 | Bacteria | 3878 |
| 80 | Ga0466727_003423 | 3300042655 | Bacteria | 1226 |
| 81 | Ga0466718_039200 | 3300042617 | Bacteria | 3013 |
| 82 | Ga0466718_095604 | 3300042617 | Bacteria | 3092 |
| 83 | Ga0466718_147364 | 3300042617 | Bacteria | 21998 |
| 84 | Ga0466723_180975 | 3300042618 | Bacteria | 8729 |
| 85 | Ga0466716_281805 | 3300042605 | Bacteria | 3817 |
| 86 | Ga0466698_083770 | 3300042610 | Bacteria | 10096 |
| 87 | Ga0123356_10002040 | 3300010049 | Bacteria | 21761 |
| 88 | Ga0466692_142303 | 3300042591 | Bacteria | 11124 |
| 89 | Ga0466699_020661 | 3300042597 | Bacteria | 15510 |
| 90 | Ga0466699_246505 | 3300042597 | Bacteria | 5467 |
| 91 | Ga0466699_284827 | 3300042597 | Bacteria | 14833 |
| 92 | Ga0466699_402495 | 3300042597 | Bacteria | 1102 |
| 93 | JGI24698J34947_10016205 | 3300002449 | Bacteria | 4047 |
| 94 | JGI24695J34938_10001898 | 3300002450 | Bacteria | 16909 |
| 95 | JGI24695J34938_10009375 | 3300002450 | Bacteria | 5448 |
| 96 | Ga0072940_1012377 | 3300005200 | Bacteria | 4537 |
| 97 | Ga0072941_1020691 | 3300005201 | Bacteria | 3154 |
| 98 | Ga0466704_122002 | 3300042643 | Bacteria | 30457 |
| 99 | Ga0466704_372601 | 3300042643 | Bacteria | 3303 |
| 100 | Ga0466712_060583 | 3300042614 | Bacteria | 12544 |
| 101 | Ga0466712_128666 | 3300042614 | Bacteria | 4277 |
| 102 | Ga0466715_140735 | 3300042616 | Bacteria | 12507 |
| 103 | Ga0466718_025580 | 3300042617 | Bacteria | 3087 |
| 104 | Ga0466718_102936 | 3300042617 | Bacteria | 3220 |
| 105 | Ga0466723_184630 | 3300042618 | Bacteria | 5689 |
| 106 | Ga0466726_097154 | 3300042619 | Bacteria | 2843 |
| 107 | Ga0466720_030398 | 3300042607 | Bacteria | 8380 |
| 108 | Ga0466720_047027 | 3300042607 | Bacteria | 12219 |
| 109 | Ga0466722_237965 | 3300042609 | Bacteria | 34947 |
| 110 | Ga0123356_10050509 | 3300010049 | Bacteria | 3869 |
| 111 | Ga0466705_003950 | 3300042612 | Bacteria | 6908 |
| 112 | Ga0466732_298068 | 3300042656 | Bacteria | 8109 |
| 113 | Ga0264413_123022 | 3300024493 | Unclassified | 2173 |
| 114 | Ga0466690_053982 | 3300042590 | Bacteria | 6284 |
| 115 | Ga0466690_073996 | 3300042590 | Bacteria | 7817 |
| 116 | Ga0466694_136825 | 3300042594 | Bacteria | 22203 |
| 117 | Ga0466696_378564 | 3300042596 | Bacteria | 2739 |
| 118 | Ga0466699_070155 | 3300042597 | Bacteria | 13589 |
| 119 | Ga0466699_216175 | 3300042597 | Bacteria | 4816 |
| 120 | AustNasuHG_c1000242 | 3300000089 | Bacteria | 18428 |
| 121 | AustNasuHG_c1002550 | 3300000089 | Bacteria | 6586 |
| 122 | JGI24698J34947_10032481 | 3300002449 | Bacteria | 2740 |
| 123 | JGI24698J34947_10072492 | 3300002449 | Unclassified | 1648 |
| 124 | JGI24695J34938_10051615 | 3300002450 | Bacteria | 1798 |
| 125 | JGI24695J34938_10079971 | 3300002450 | Bacteria | 1351 |
| 126 | Ga0072941_1000579 | 3300005201 | Bacteria | 109731 |
| 127 | Ga0072941_1141036 | 3300005201 | Bacteria | 3420 |
| 128 | Ga0466704_231113 | 3300042643 | Bacteria | 17132 |
| 129 | Ga0466709_090791 | 3300042648 | Bacteria | 4697 |
| 130 | Ga0466708_346153 | 3300042652 | Bacteria | 2956 |
| 131 | Ga0466712_113995 | 3300042614 | Bacteria | 6907 |
| 132 | Ga0466712_142458 | 3300042614 | Bacteria | 2290 |
| 133 | Ga0466718_044945 | 3300042617 | Bacteria | 6992 |
| 134 | Ga0466719_132315 | 3300042606 | Bacteria | 14338 |
| 135 | Ga0466719_146226 | 3300042606 | Bacteria | 1692 |
| 136 | Ga0466720_115436 | 3300042607 | Bacteria | 52557 |
| 137 | Ga0123353_10172411 | 3300010167 | Bacteria | 3433 |
| 138 | Ga0466705_157760 | 3300042612 | Bacteria | 4174 |
| 139 | Ga0466691_216333 | 3300042593 | Bacteria | 2456 |
| 140 | JGI24698J34947_10008212 | 3300002449 | Bacteria | 5727 |
| 141 | JGI24698J34947_10070133 | 3300002449 | Bacteria | 1689 |
| 142 | Ga0466709_323719 | 3300042648 | Bacteria | 2180 |
| 143 | Ga0466712_049384 | 3300042614 | Bacteria | 5141 |
| 144 | Ga0466712_122942 | 3300042614 | Bacteria | 4259 |
| 145 | Ga0466718_063158 | 3300042617 | Bacteria | 5272 |
| 146 | Ga0466723_047623 | 3300042618 | Bacteria | 4074 |
| 147 | Ga0466726_075885 | 3300042619 | Bacteria | 8782 |
| 148 | Ga0466728_300370 | 3300042620 | Bacteria | 4884 |
| 149 | Ga0466720_203446 | 3300042607 | Bacteria | 6620 |
| 150 | Ga0123353_10213051 | 3300010167 | Bacteria | 3028 |
| 151 | Ga0123353_10533906 | 3300010167 | Archaea | 1697 |
| 152 | Ga0466732_119877 | 3300042656 | Bacteria | 14151 |
| 153 | Ga0264413_108708 | 3300024493 | Bacteria | 3993 |
| 154 | Ga0264413_112101 | 3300024493 | Bacteria | 5161 |
| 155 | Ga0264413_118425 | 3300024493 | Bacteria | 3498 |
| 156 | Ga0466692_027843 | 3300042591 | Bacteria | 5851 |
| 157 | Ga0466694_050440 | 3300042594 | Bacteria | 148325 |
| 158 | Ga0466696_271238 | 3300042596 | Bacteria | 2575 |
| 159 | Ga0466699_094667 | 3300042597 | Bacteria | 5557 |
| 160 | Ga0466699_140170 | 3300042597 | Bacteria | 7515 |
| 161 | Ga0466699_209802 | 3300042597 | Bacteria | 4825 |
| 162 | Ga0466699_229331 | 3300042597 | Bacteria | 37974 |
| 163 | AustNasuHG_c1001886 | 3300000089 | Bacteria | 7557 |
| 164 | JGI24698J34947_10028573 | 3300002449 | Bacteria | 2952 |
| 165 | JGI24698J34947_10037925 | 3300002449 | Bacteria | 2502 |
| 166 | JGI24695J34938_10000152 | 3300002450 | Bacteria | 63361 |
| 167 | JGI24695J34938_10019377 | 3300002450 | Bacteria | 3374 |
| 168 | Ga0072940_1008788 | 3300005200 | Bacteria | 12159 |
| 169 | Ga0466708_176927 | 3300042652 | Bacteria | 2178 |
| 170 | Ga0466712_267664 | 3300042614 | Bacteria | 1851 |
| 171 | Ga0466712_304258 | 3300042614 | Bacteria | 4166 |
| 172 | Ga0466715_179417 | 3300042616 | Bacteria | 1511 |
| 173 | Ga0466715_204009 | 3300042616 | Bacteria | 3321 |
| 174 | Ga0466723_127591 | 3300042618 | Bacteria | 10587 |
| 175 | Ga0466700_238974 | 3300042600 | Bacteria | 1449 |
| 176 | Ga0466707_082114 | 3300042601 | Bacteria | 3689 |
| 177 | Ga0466716_455715 | 3300042605 | Bacteria | 3435 |
| 178 | Ga0466720_130422 | 3300042607 | Bacteria | 5776 |
| 179 | Ga0466720_210159 | 3300042607 | Bacteria | 13825 |
| 180 | Ga0466722_262265 | 3300042609 | Bacteria | 11596 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03793 | PASTA | PASTA domain | 91 | 152 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.