Protein Family IF01353

Metagenome Isolate
139 Members
56 Samples
126 Scaffolds
192.21 Avg Length

🧬 Representative Sequence

ID
3300005201|Ga0072941_1126255|Ga0072941_11262553
Length
221 aa
Sequence
LIDIKKDVRYNEGRRSDDNNGYGTGPIIMSPKKNSIDQDRVVAAVREILIAIGEDPDREGLRETPHRVARMYQELFSGLHEDPATYTKKFFSENYNEIVLVRNISFNSVCEHHLMPFMGVIHIGYIPDGRVIGLSKLARVIEVFSHRPQIQERLTEDIAELLYRELKAKAVAVVVEAEHTCMTVRGVKKPGSLCVTSALRXGFLKHPSSRAEIFSLINKR*

📊 Sample Types

Isolate 9.3%
Metagenome 90.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 36.4%
Unclassified 27.3%
Kalotermitidae 23.6%
Rhinotermitidae 5.5%
Termopsidae 5.5%
Passalidae 1.8%

🌳 Taxonomy

Archaea 0
Bacteria 101
Eukaryota 0
Viruses 0
Unclassified 38

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
2 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
3 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
6 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
7 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
8 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 2820205024 Unclassified Planctomycetes Cu122P4bin3 Isolate Unclassified
11 2820447167 Unclassified Firmicutes Lab288P3bin192 Isolate Unclassified
12 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
17 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
18 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
19 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
20 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
21 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
22 2820836992 Unclassified Actinobacteria Lab288P4bin32 Isolate Unclassified
23 2820171952 Unclassified Planctomycetes Th196P3bin88 Isolate Unclassified
24 2820420508 Unclassified Firmicutes Lab288P3bin68 Isolate Unclassified
25 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
26 3300042649 Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 Metagenome Termitidae
27 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
28 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
29 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
30 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
31 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
32 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
33 2820185449 Unclassified Planctomycetes Lab288P3bin146 Isolate Unclassified
34 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
35 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
36 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
37 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
38 2820178484 Unclassified Planctomycetes Th196P3bin110 Isolate Unclassified
39 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
40 2820183396 Unclassified Planctomycetes Lab288P3bin214 Isolate Unclassified
41 2820201435 Unclassified Planctomycetes Cu122P5bin25 Isolate Unclassified
42 2820558799 Unclassified Firmicutes Emb289P3bin74 Isolate Unclassified
43 2820403592 Unclassified Firmicutes Lab288P4bin93 Isolate Unclassified
44 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
45 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
46 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
47 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
48 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
49 2820180635 Unclassified Planctomycetes Lab288P3bin24 Isolate Unclassified
50 2820196379 Unclassified Planctomycetes Emb289P3bin158 Isolate Unclassified
51 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
52 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
55 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
56 3300002834 Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466733_132803 3300042659 Unclassified 1667
2 JGI24702J35022_10008838 3300002462 Bacteria 5687
3 Ga0072941_1075115 3300005201 Bacteria 2727
4 Ga0466717_057500 3300042604 Unclassified 1611
5 Ga0466717_228813 3300042604 Bacteria 1772
6 Ga0466719_541590 3300042606 Bacteria 23884
7 Ga0123356_10259613 3300010049 Unclassified 1820
8 Ga0123353_10293436 3300010167 Unclassified 2487
9 Ga0466703_157905 3300042636 Bacteria 36801
10 Ga0466695_033301 3300042595 Bacteria 1201
11 Ga0466695_404869 3300042595 Unclassified 1396
12 Ga0466715_021064 3300042616 Unclassified 2563
13 Ga0466718_048024 3300042617 Bacteria 3107
14 Ga0466713_075498 3300042602 Bacteria 1307
15 Ga0466719_450658 3300042606 Unclassified 2405
16 Ga0466721_183850 3300042608 Unclassified 1586
17 Ga0466698_194705 3300042610 Bacteria 2062
18 Ga0123356_10798427 3300010049 Unclassified 1115
19 Ga0123353_10005296 3300010167 Bacteria 16886
20 Ga0123353_10006729 3300010167 Bacteria 15395
21 Ga0123353_10024170 3300010167 Bacteria 9219
22 Ga0123353_10086124 3300010167 Unclassified 5060
23 Ga0123353_10088794 3300010167 Bacteria 4978
24 Ga0123353_10307152 3300010167 Unclassified 2417
25 Ga0123353_10963925 3300010167 Unclassified 1152
26 Ga0123354_10125126 3300010882 Bacteria 3289
27 Ga0466702_030239 3300042635 Bacteria 1856
28 Ga0466703_072497 3300042636 Unclassified 1395
29 Ga0466724_53899 3300042649 Bacteria 1360
30 Ga0466727_020505 3300042655 Bacteria 1539
31 Ga0466715_167242 3300042616 Bacteria 5176
32 JGI24695J34938_10103822 3300002450 Unclassified 1160
33 Ga0072941_1370980 3300005201 Bacteria 748
34 Ga0466707_259873 3300042601 Bacteria 1173
35 Ga0466707_297716 3300042601 Bacteria 19963
36 Ga0466719_137295 3300042606 Bacteria 3768
37 Ga0466721_189820 3300042608 Bacteria 19859
38 Ga0466722_058015 3300042609 Bacteria 2298
39 Ga0123356_10091985 3300010049 Bacteria 2892
40 Ga0123356_10131238 3300010049 Bacteria 2455
41 Ga0123356_10490231 3300010049 Bacteria 1383
42 Ga0123356_10843817 3300010049 Bacteria 1087
43 Ga0123353_10000099 3300010167 Unclassified 99230
44 Ga0123353_10001990 3300010167 Bacteria 25255
45 Ga0123353_10058035 3300010167 Bacteria 6201
46 Ga0123353_12419426 3300010167 Bacteria 627
47 Ga0466705_072554 3300042612 Bacteria 1353
48 Ga0466712_106380 3300042614 Bacteria 1093
49 Ga0466726_400691 3300042619 Bacteria 22409
50 JGI24695J34938_10184853 3300002450 Unclassified 864
51 JGI24702J35022_10321438 3300002462 Bacteria 918
52 Ga0072941_1656293 3300005201 Unclassified 827
53 Ga0466700_302615 3300042600 Bacteria 4330
54 Ga0123356_10253164 3300010049 Bacteria 1840
55 Ga0123356_11243608 3300010049 Bacteria 909
56 Ga0123353_10000692 3300010167 Bacteria 41246
57 Ga0466704_312646 3300042643 Bacteria 13697
58 Ga0466709_175323 3300042648 Bacteria 1001
59 Ga0466695_054612 3300042595 Bacteria 3753
60 Ga0466723_096761 3300042618 Bacteria 4713
61 Ga0466726_060475 3300042619 Bacteria 13846
62 Ga0466726_163059 3300042619 Bacteria 20044
63 2227587668 2225789004 Bacteria 2453
64 JGI24702J35022_10064702 3300002462 Bacteria 1961
65 JGI24696J40584_12814579 3300002834 Unclassified 895
66 JGI24696J40584_12893510 3300002834 Unclassified 1143
67 Ga0466700_403948 3300042600 Bacteria 1830
68 Ga0466716_280748 3300042605 Unclassified 2375
69 Ga0466721_009261 3300042608 Unclassified 1711
70 Ga0123354_10112476 3300010882 Bacteria 3584
71 Ga0466734_111785 3300042623 Bacteria 2012
72 Ga0415639_111679 3300038395 Bacteria 4614
73 Ga0466692_183477 3300042591 Bacteria 34200
74 Ga0466696_079522 3300042596 Bacteria 4402
75 Ga0466733_000390 3300042659 Bacteria 12873
76 Ga0466723_322906 3300042618 Bacteria 13107
77 Ga0466728_137875 3300042620 Bacteria 4985
78 JGI24702J35022_10032387 3300002462 Bacteria 2799
79 Ga0466717_060093 3300042604 Bacteria 3680
80 Ga0466722_256166 3300042609 Bacteria 78068
81 Ga0466698_438601 3300042610 Bacteria 1037
82 Ga0123356_10000616 3300010049 Bacteria 39379
83 Ga0123356_10187797 3300010049 Unclassified 2094
84 Ga0123353_10176996 3300010167 Unclassified 3381
85 Ga0123353_11284328 3300010167 Bacteria 952
86 Ga0123353_11329183 3300010167 Unclassified 931
87 Ga0466703_140849 3300042636 Bacteria 4327
88 Ga0466708_168052 3300042652 Bacteria 10031
89 Ga0415639_027858 3300038395 Unclassified 1077
90 Ga0466705_385384 3300042612 Unclassified 1458
91 Ga0466711_173048 3300042615 Unclassified 1075
92 Ga0466711_227395 3300042615 Bacteria 10559
93 Ga0466711_316226 3300042615 Bacteria 20174
94 Ga0466715_225563 3300042616 Unclassified 2489
95 Ga0466718_114883 3300042617 Bacteria 1911
96 Ga0466723_134522 3300042618 Unclassified 19435
97 2227479350 2225789004 Bacteria 4504
98 Ga0466707_233846 3300042601 Unclassified 1406
99 Ga0466707_270370 3300042601 Bacteria 1666
100 Ga0466714_020438 3300042603 Bacteria 44985
101 Ga0466717_301192 3300042604 Bacteria 1839
102 Ga0123357_10124088 3300009784 Bacteria 3241
103 Ga0123356_10017261 3300010049 Unclassified 6869
104 Ga0123356_10690271 3300010049 Unclassified 1189
105 Ga0123354_10061302 3300010882 Bacteria 5553
106 Ga0123354_10157319 3300010882 Unclassified 2719
107 Ga0466729_220230 3300042621 Bacteria 2397
108 Ga0466704_522234 3300042643 Unclassified 3237
109 Ga0466727_240495 3300042655 Bacteria 10196
110 Ga0466691_014721 3300042593 Bacteria 18211
111 Ga0466729_176687 3300042621 Bacteria 4431
112 Ga0068302_10055971 3300005071 Bacteria 797
113 Ga0072941_1126255 3300005201 Bacteria 3857
114 Ga0466700_138746 3300042600 Bacteria 1637
115 Ga0466722_106489 3300042609 Bacteria 23272
116 Ga0466698_219184 3300042610 Bacteria 1053
117 Ga0466698_494417 3300042610 Bacteria 4479
118 Ga0123356_10044977 3300010049 Unclassified 4109
119 Ga0123356_10230699 3300010049 Bacteria 1915
120 Ga0123356_10719925 3300010049 Bacteria 1167
121 Ga0123353_10006185 3300010167 Unclassified 15898
122 Ga0123353_10030316 3300010167 Bacteria 8357
123 Ga0466734_032876 3300042623 Unclassified 1442
124 Ga0466708_423564 3300042652 Bacteria 6676
125 Ga0466727_215228 3300042655 Unclassified 1292
126 Ga0466696_055567 3300042596 Bacteria 6898

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300010882 Ga0123354_10157319 Ga0123354_101573193 169
2 3300002462 JGI24702J35022_10032387 JGI24702J35022_100323872 171
3 3300042636 Ga0466703_157905 Ga0466703_157905_24436_24987 178
4 3300010049 Ga0123356_10690271 Ga0123356_106902711 181
5 3300042596 Ga0466696_055567 Ga0466696_055567_3604_4203 181
6 3300042610 Ga0466698_438601 Ga0466698_438601_187_735 182
7 3300042609 Ga0466722_058015 Ga0466722_058015_130_684 184
8 3300042609 Ga0466722_256166 Ga0466722_256166_4291_4845 184
9 3300042614 Ga0466712_106380 Ga0466712_106380_66_620 184
10 3300042619 Ga0466726_400691 Ga0466726_400691_8909_9463 184
11 2225789004 2227479350 2227935618 185
12 3300010049 Ga0123356_10843817 Ga0123356_108438172 185
13 3300042608 Ga0466721_189820 Ga0466721_189820_8927_9484 185
14 3300042615 Ga0466711_227395 Ga0466711_227395_1965_2522 185
15 iso_pr_bacteria 2820420508 2820420550 185
16 3300010049 Ga0123356_10091985 Ga0123356_100919852 186
17 3300010167 Ga0123353_10001990 Ga0123353_100019909 186
18 3300042600 Ga0466700_403948 Ga0466700_403948_927_1487 186
19 3300042601 Ga0466707_259873 Ga0466707_259873_509_1126 186
20 3300042601 Ga0466707_297716 Ga0466707_297716_15002_15562 186
21 3300042605 Ga0466716_280748 Ga0466716_280748_614_1174 186
22 3300042612 Ga0466705_385384 Ga0466705_385384_228_788 186
23 3300042616 Ga0466715_225563 Ga0466715_225563_891_1451 186
24 3300042618 Ga0466723_134522 Ga0466723_134522_354_914 186
25 3300042618 Ga0466723_322906 Ga0466723_322906_9175_9735 186
26 3300042636 Ga0466703_072497 Ga0466703_072497_236_796 186
27 3300042652 Ga0466708_168052 Ga0466708_168052_1604_2164 186
28 3300042652 Ga0466708_423564 Ga0466708_423564_2996_3556 186
29 3300042655 Ga0466727_020505 Ga0466727_020505_111_671 186
30 3300042659 Ga0466733_000390 Ga0466733_000390_5351_5911 186
31 iso_pr_bacteria 2820403592 2820404908 186
32 iso_pr_bacteria 2820447167 2820447952 186
33 3300002462 JGI24702J35022_10008838 JGI24702J35022_100088382 187
34 3300002462 JGI24702J35022_10064702 JGI24702J35022_100647022 187
35 3300009784 Ga0123357_10124088 Ga0123357_101240882 187
36 3300010167 Ga0123353_10030316 Ga0123353_100303162 187
37 3300010882 Ga0123354_10112476 Ga0123354_101124763 187
38 3300042595 Ga0466695_033301 Ga0466695_033301_61_624 187
39 3300042604 Ga0466717_057500 Ga0466717_057500_543_1106 187
40 3300042604 Ga0466717_060093 Ga0466717_060093_133_696 187
41 3300042610 Ga0466698_219184 Ga0466698_219184_341_904 187
42 3300042619 Ga0466726_060475 Ga0466726_060475_2770_3333 187
43 3300042635 Ga0466702_030239 Ga0466702_030239_324_887 187
44 iso_pr_bacteria 2820836992 2820837931 187
45 3300002462 JGI24702J35022_10321438 JGI24702J35022_103214382 188
46 3300005071 Ga0068302_10055971 Ga0068302_100559712 188
47 3300005201 Ga0072941_1075115 Ga0072941_10751153 188
48 3300010049 Ga0123356_10230699 Ga0123356_102306992 188
49 3300010049 Ga0123356_11243608 Ga0123356_112436081 188
50 3300010167 Ga0123353_10006185 Ga0123353_100061858 188
51 3300010167 Ga0123353_12419426 Ga0123353_124194261 188
52 3300010882 Ga0123354_10125126 Ga0123354_101251262 188
53 3300042595 Ga0466695_404869 Ga0466695_404869_322_888 188
54 3300042604 Ga0466717_301192 Ga0466717_301192_698_1264 188
55 iso_pr_bacteria 2820558799 2820559291 188
56 3300010049 Ga0123356_10000616 Ga0123356_1000061620 189
57 3300010049 Ga0123356_10490231 Ga0123356_104902311 189
58 3300042609 Ga0466722_106489 Ga0466722_106489_11975_12544 189
59 3300042603 Ga0466714_020438 Ga0466714_020438_26693_27265 190
60 3300042593 Ga0466691_014721 Ga0466691_014721_10788_11363 191
61 3300042604 Ga0466717_228813 Ga0466717_228813_1065_1640 191
62 3300042606 Ga0466719_137295 Ga0466719_137295_2393_2968 191
63 3300042612 Ga0466705_072554 Ga0466705_072554_456_1031 191
64 3300042616 Ga0466715_021064 Ga0466715_021064_381_956 191
65 3300042643 Ga0466704_522234 Ga0466704_522234_321_896 191
66 3300010167 Ga0123353_10005296 Ga0123353_1000529614 192
67 3300010167 Ga0123353_10024170 Ga0123353_100241707 192
68 3300042600 Ga0466700_302615 Ga0466700_302615_136_714 192
69 3300042608 Ga0466721_009261 Ga0466721_009261_484_1062 192
70 3300042608 Ga0466721_183850 Ga0466721_183850_10_588 192
71 3300042643 Ga0466704_312646 Ga0466704_312646_11216_11794 192
72 3300042649 Ga0466724_53899 Ga0466724_53899_172_750 192
73 3300042659 Ga0466733_132803 Ga0466733_132803_860_1438 192
74 iso_pr_bacteria 2820180635 2820181265 192
75 3300002834 JGI24696J40584_12893510 JGI24696J40584_128935102 193
76 3300005201 Ga0072941_1370980 Ga0072941_13709801 193
77 3300005201 Ga0072941_1656293 Ga0072941_16562931 193
78 3300010049 Ga0123356_10017261 Ga0123356_100172613 193
79 3300010049 Ga0123356_10131238 Ga0123356_101312383 193
80 3300010167 Ga0123353_10006729 Ga0123353_1000672911 193
81 3300010167 Ga0123353_10086124 Ga0123353_100861243 193
82 3300010882 Ga0123354_10061302 Ga0123354_100613023 193
83 3300038395 Ga0415639_027858 Ga0415639_027858_124_753 193
84 3300042619 Ga0466726_163059 Ga0466726_163059_19078_19659 193
85 3300042621 Ga0466729_176687 Ga0466729_176687_1445_2026 193
86 3300042623 Ga0466734_111785 Ga0466734_111785_999_1580 193
87 3300042655 Ga0466727_215228 Ga0466727_215228_245_826 193
88 3300042655 Ga0466727_240495 Ga0466727_240495_107_688 193
89 3300010167 Ga0123353_11284328 Ga0123353_112843281 194
90 3300042606 Ga0466719_450658 Ga0466719_450658_713_1297 194
91 3300042610 Ga0466698_194705 Ga0466698_194705_1059_1643 194
92 3300042617 Ga0466718_048024 Ga0466718_048024_1056_1640 194
93 3300042618 Ga0466723_096761 Ga0466723_096761_3917_4501 194
94 iso_pr_bacteria 2820178484 2820179685 194
95 iso_pr_bacteria 2820205024 2820205074 194
96 3300002450 JGI24695J34938_10184853 JGI24695J34938_101848531 195
97 3300002834 JGI24696J40584_12814579 JGI24696J40584_128145791 195
98 3300042601 Ga0466707_233846 Ga0466707_233846_800_1387 195
99 3300042620 Ga0466728_137875 Ga0466728_137875_739_1326 195
100 3300010049 Ga0123356_10253164 Ga0123356_102531642 196
101 3300042595 Ga0466695_054612 Ga0466695_054612_1244_1834 196
102 3300042615 Ga0466711_316226 Ga0466711_316226_8788_9378 196
103 iso_pr_bacteria 2820183396 2820183690 196
104 3300010167 Ga0123353_10000099 Ga0123353_1000009916 197
105 3300010167 Ga0123353_10000692 Ga0123353_100006926 197
106 3300042600 Ga0466700_138746 Ga0466700_138746_569_1162 197
107 3300042617 Ga0466718_114883 Ga0466718_114883_869_1462 197
108 3300042623 Ga0466734_032876 Ga0466734_032876_568_1161 197
109 iso_pr_bacteria 2820171952 2820174787 197
110 iso_pr_bacteria 2820196379 2820198368 197
111 3300002450 JGI24695J34938_10103822 JGI24695J34938_101038221 198
112 3300010049 Ga0123356_10044977 Ga0123356_100449772 198
113 3300010049 Ga0123356_10798427 Ga0123356_107984271 198
114 3300010167 Ga0123353_10088794 Ga0123353_100887943 198
115 3300010167 Ga0123353_10176996 Ga0123353_101769963 198
116 3300010167 Ga0123353_10293436 Ga0123353_102934362 198
117 3300010167 Ga0123353_10307152 Ga0123353_103071522 198
118 3300010167 Ga0123353_10963925 Ga0123353_109639252 198
119 3300010049 Ga0123356_10187797 Ga0123356_101877972 199
120 3300010167 Ga0123353_10058035 Ga0123353_100580352 199
121 3300042601 Ga0466707_270370 Ga0466707_270370_118_717 199
122 3300042610 Ga0466698_494417 Ga0466698_494417_1814_2467 199
123 3300042621 Ga0466729_220230 Ga0466729_220230_1410_2009 199
124 iso_pr_bacteria 2820201435 2820203273 199
125 3300010049 Ga0123356_10719925 Ga0123356_107199252 200
126 iso_pr_bacteria 2820185449 2820186009 200
127 3300042591 Ga0466692_183477 Ga0466692_183477_20563_21168 201
128 3300042606 Ga0466719_541590 Ga0466719_541590_17653_18261 202
129 3300042596 Ga0466696_079522 Ga0466696_079522_3645_4256 203
130 3300042615 Ga0466711_173048 Ga0466711_173048_197_811 204
131 3300038395 Ga0415639_111679 Ga0415639_111679_1259_1879 206
132 3300042616 Ga0466715_167242 Ga0466715_167242_2245_2868 207
133 3300010049 Ga0123356_10259613 Ga0123356_102596132 208
134 3300010167 Ga0123353_11329183 Ga0123353_113291831 208
135 3300042602 Ga0466713_075498 Ga0466713_075498_592_1224 210
136 3300042636 Ga0466703_140849 Ga0466703_140849_2291_2929 212
137 2225789004 2227587668 2228143923 213
138 3300042648 Ga0466709_175323 Ga0466709_175323_310_951 213
139 3300005201 Ga0072941_1126255 Ga0072941_11262553 221

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01227 GTP_cyclohydroI GTP cyclohydrolase I 43 217 0.98

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.79 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.