Protein Family IF01336
Metagenome
Isolate
115
Members
38
Samples
109
Scaffolds
260.51
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1068329|Ga0072941_10683292
- Length
- 254 aa
- Sequence
- MPYKHGRPVIDLSPFFRIASAWGFYLTIPIAFLVNFSMFLTRYKHRYRMYNVKKAITVSNHTTFLDPVKIAALVLPRLIFQTLLEATVEFPILGTYTRILGGVPVPRGLKGYKKILESFKTRRYLHFYPEGECYLYNQNIREFKTGAFLIAAEMDIPVVPLVTVFSEGPFKPWSFWGRSLPLETLVVLDPVYPSQYVRRDQNGELDSASIREFAEAVRQKMQAEIDKRGGSSAFFRGHMDRIKGLNDKVPVSN*
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Kalotermitidae
27.8%
Unclassified
13.9%
Rhinotermitidae
2.8%
Blaberidae
2.8%
Termopsidae
2.8%
Taxonomy
Archaea
0
Bacteria
107
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 2 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 3 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 4 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 5 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 6 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 9 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 10 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 11 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 12 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 13 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 14 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 15 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 16 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 23 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 24 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 25 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 31 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 32 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 33 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 34 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 37 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466712_019913 | 3300042614 | Bacteria | 18083 |
| 2 | Ga0466712_282134 | 3300042614 | Bacteria | 5606 |
| 3 | Ga0466712_289247 | 3300042614 | Bacteria | 3994 |
| 4 | Ga0466712_316838 | 3300042614 | Bacteria | 9868 |
| 5 | Ga0466700_377206 | 3300042600 | Bacteria | 3694 |
| 6 | Ga0123353_10304127 | 3300010167 | Bacteria | 2432 |
| 7 | JGI24698J34947_10002160 | 3300002449 | Bacteria | 10543 |
| 8 | JGI24698J34947_10005082 | 3300002449 | Bacteria | 7205 |
| 9 | JGI24698J34947_10009653 | 3300002449 | Bacteria | 5289 |
| 10 | JGI24698J34947_10011838 | 3300002449 | Unclassified | 4791 |
| 11 | JGI24695J34938_10000846 | 3300002450 | Bacteria | 28385 |
| 12 | Ga0072941_1068330 | 3300005201 | Unclassified | 1409 |
| 13 | Ga0466731_000344 | 3300042622 | Bacteria | 14290 |
| 14 | Ga0466709_005784 | 3300042648 | Bacteria | 3760 |
| 15 | Ga0466708_296757 | 3300042652 | Bacteria | 8156 |
| 16 | Ga0466693_186633 | 3300042592 | Bacteria | 79738 |
| 17 | Ga0466712_076054 | 3300042614 | Bacteria | 15237 |
| 18 | Ga0466712_279128 | 3300042614 | Bacteria | 7550 |
| 19 | Ga0466723_193953 | 3300042618 | Bacteria | 4702 |
| 20 | Ga0466728_247328 | 3300042620 | Bacteria | 5914 |
| 21 | Ga0466707_204413 | 3300042601 | Bacteria | 2734 |
| 22 | Ga0123357_10157393 | 3300009784 | Bacteria | 2736 |
| 23 | AustNasuHG_c1023137 | 3300000089 | Unclassified | 1988 |
| 24 | Ga0072941_1001616 | 3300005201 | Bacteria | 13955 |
| 25 | Ga0072941_1040161 | 3300005201 | Bacteria | 8770 |
| 26 | Ga0072941_1053360 | 3300005201 | Bacteria | 4038 |
| 27 | Ga0466731_329935 | 3300042622 | Bacteria | 2818 |
| 28 | Ga0466712_055330 | 3300042614 | Unclassified | 2870 |
| 29 | Ga0466712_095931 | 3300042614 | Bacteria | 14319 |
| 30 | Ga0466718_030218 | 3300042617 | Bacteria | 5732 |
| 31 | Ga0466716_501654 | 3300042605 | Bacteria | 2499 |
| 32 | Ga0466722_084381 | 3300042609 | Bacteria | 43243 |
| 33 | JGI24698J34947_10018240 | 3300002449 | Bacteria | 3794 |
| 34 | JGI24695J34938_10051701 | 3300002450 | Bacteria | 1796 |
| 35 | JGI24696J40584_12957449 | 3300002834 | Bacteria | 3520 |
| 36 | Ga0466702_066788 | 3300042635 | Bacteria | 2391 |
| 37 | Ga0466691_125200 | 3300042593 | Bacteria | 7452 |
| 38 | Ga0466696_023950 | 3300042596 | Bacteria | 3809 |
| 39 | Ga0466712_036596 | 3300042614 | Bacteria | 17970 |
| 40 | Ga0466712_197398 | 3300042614 | Bacteria | 4743 |
| 41 | Ga0123356_10009490 | 3300010049 | Bacteria | 9610 |
| 42 | JGI24698J34947_10001342 | 3300002449 | Bacteria | 12947 |
| 43 | JGI24698J34947_10026637 | 3300002449 | Bacteria | 3071 |
| 44 | JGI24698J34947_10034682 | 3300002449 | Bacteria | 2638 |
| 45 | JGI24698J34947_10039192 | 3300002449 | Bacteria | 2454 |
| 46 | JGI24698J34947_10062103 | 3300002449 | Bacteria | 1836 |
| 47 | JGI24695J34938_10000245 | 3300002450 | Bacteria | 52223 |
| 48 | Ga0072940_1021687 | 3300005200 | Bacteria | 2550 |
| 49 | Ga0072941_1018317 | 3300005201 | Bacteria | 2363 |
| 50 | Ga0072941_1018320 | 3300005201 | Bacteria | 6689 |
| 51 | Ga0072941_1029378 | 3300005201 | Bacteria | 4449 |
| 52 | Ga0072941_1068329 | 3300005201 | Bacteria | 1891 |
| 53 | Ga0466702_110946 | 3300042635 | Bacteria | 1442 |
| 54 | Ga0466709_004059 | 3300042648 | Bacteria | 3889 |
| 55 | Ga0466727_039206 | 3300042655 | Bacteria | 2962 |
| 56 | Ga0264413_115014 | 3300024493 | Bacteria | 12573 |
| 57 | Ga0264413_123083 | 3300024493 | Bacteria | 7735 |
| 58 | Ga0466693_419874 | 3300042592 | Bacteria | 3719 |
| 59 | Ga0466712_210687 | 3300042614 | Bacteria | 11046 |
| 60 | Ga0466715_001364 | 3300042616 | Bacteria | 11977 |
| 61 | Ga0466718_159364 | 3300042617 | Bacteria | 5537 |
| 62 | Ga0466718_161575 | 3300042617 | Bacteria | 1734 |
| 63 | JGI24698J34947_10001464 | 3300002449 | Bacteria | 12432 |
| 64 | JGI24698J34947_10002259 | 3300002449 | Bacteria | 10320 |
| 65 | JGI24698J34947_10004929 | 3300002449 | Bacteria | 7314 |
| 66 | JGI24698J34947_10034633 | 3300002449 | Unclassified | 2640 |
| 67 | Ga0072941_1040268 | 3300005201 | Bacteria | 13976 |
| 68 | Ga0072941_1045543 | 3300005201 | Bacteria | 3829 |
| 69 | Ga0466690_305817 | 3300042590 | Bacteria | 1608 |
| 70 | Ga0466691_219934 | 3300042593 | Bacteria | 9518 |
| 71 | Ga0466694_076450 | 3300042594 | Bacteria | 26319 |
| 72 | Ga0466712_017336 | 3300042614 | Bacteria | 30893 |
| 73 | Ga0466712_082916 | 3300042614 | Bacteria | 3004 |
| 74 | Ga0466712_202792 | 3300042614 | Bacteria | 9583 |
| 75 | Ga0466723_207332 | 3300042618 | Bacteria | 6867 |
| 76 | Ga0123357_10060377 | 3300009784 | Bacteria | 5086 |
| 77 | AustNasuHG_c1001560 | 3300000089 | Bacteria | 8255 |
| 78 | JGI24698J34947_10001046 | 3300002449 | Bacteria | 14257 |
| 79 | JGI24698J34947_10008050 | 3300002449 | Bacteria | 5786 |
| 80 | JGI24698J34947_10072284 | 3300002449 | Bacteria | 1652 |
| 81 | JGI24698J34947_10136498 | 3300002449 | Unclassified | 1040 |
| 82 | JGI24695J34938_10014243 | 3300002450 | Bacteria | 4133 |
| 83 | Ga0072941_1009359 | 3300005201 | Bacteria | 34397 |
| 84 | Ga0072941_1018319 | 3300005201 | Bacteria | 8459 |
| 85 | Ga0072941_1020573 | 3300005201 | Bacteria | 18138 |
| 86 | Ga0466703_066674 | 3300042636 | Bacteria | 13204 |
| 87 | Ga0466712_080364 | 3300042614 | Bacteria | 2673 |
| 88 | Ga0466720_099903 | 3300042607 | Bacteria | 25510 |
| 89 | Ga0466722_065259 | 3300042609 | Bacteria | 1991 |
| 90 | JGI24698J34947_10005191 | 3300002449 | Bacteria | 7144 |
| 91 | Ga0072940_1021688 | 3300005200 | Bacteria | 4149 |
| 92 | Ga0072940_1022044 | 3300005200 | Bacteria | 5065 |
| 93 | Ga0466703_030641 | 3300042636 | Bacteria | 6965 |
| 94 | Ga0466732_446957 | 3300042656 | Bacteria | 15153 |
| 95 | Ga0466712_045719 | 3300042614 | Unclassified | 3402 |
| 96 | Ga0466712_058559 | 3300042614 | Bacteria | 28216 |
| 97 | Ga0466712_077919 | 3300042614 | Bacteria | 28252 |
| 98 | Ga0466718_112735 | 3300042617 | Bacteria | 2386 |
| 99 | JGI24698J34947_10001772 | 3300002449 | Bacteria | 11509 |
| 100 | JGI24698J34947_10004905 | 3300002449 | Bacteria | 7330 |
| 101 | JGI24698J34947_10008325 | 3300002449 | Bacteria | 5688 |
| 102 | JGI24698J34947_10029776 | 3300002449 | Bacteria | 2882 |
| 103 | JGI24698J34947_10034382 | 3300002449 | Bacteria | 2653 |
| 104 | JGI24698J34947_10055107 | 3300002449 | Bacteria | 1982 |
| 105 | Ga0072941_1133291 | 3300005201 | Bacteria | 5016 |
| 106 | Ga0466708_014822 | 3300042652 | Bacteria | 8536 |
| 107 | Ga0466693_206602 | 3300042592 | Unclassified | 2783 |
| 108 | Ga0466694_008592 | 3300042594 | Bacteria | 11846 |
| 109 | Ga0466695_218661 | 3300042595 | Bacteria | 43087 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01553 | Acyltransferase | Acyltransferase | 51 | 162 | 0.87 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01553 | GO:0016746 | acyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.