Protein Family IF01307
Metagenome
Isolate
114
Members
30
Samples
107
Scaffolds
217.45
Avg Length
Representative Sequence
- ID
- 3300005201|Ga0072941_1024066|Ga0072941_10240662
- Length
- 234 aa
- Sequence
- MTFWVRNGRFKGGKMKVVLITALNKDFDKKLTAVFARENYKTYAMGNEQQQIDGVTLLPLDPKEAAAVLQKDAGHIDIYIDVSDERSSSDNFNIRDGMNEQVIRELYEANVLRPMAMLEAFMPLLENGEGKRLCFLTSAEASINETRAVDGFGYKMAKAGLHNFLQITRNVLAPKGYTIRAYDPMYHEVTAELSAEAALNYFTRRRGIEGGDNLRDDEGNIVFRDAYGRQHSW*
Sample Types
Isolate
6.1%
Metagenome
93.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
75.0%
Unclassified
25.0%
Taxonomy
Archaea
1
Bacteria
104
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 2 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 3 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 4 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 5 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 6 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 7 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 8 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 9 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 10 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 11 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 12 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 13 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 14 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 15 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 16 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 17 | 2820267566 | Unclassified Firmicutes Th196P3bin33 | Isolate | Unclassified |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 20 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 21 | 2030936001 | Nasutitermes corniger hindgut microbial communities from Florida, USA | Metagenome | Termitidae |
| 22 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 23 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 24 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 25 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 26 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 27 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 28 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 29 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 30 | 2781125636 | Treponema sp. Co191P1bin67 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10003305 | 3300010049 | Bacteria | 16938 |
| 2 | Ga0466712_036891 | 3300042614 | Bacteria | 2538 |
| 3 | Ga0466698_241290 | 3300042610 | Bacteria | 1103 |
| 4 | Nasutiter_Contig26122 | 2030936001 | Bacteria | 1839 |
| 5 | JGI24698J34947_10024235 | 3300002449 | Bacteria | 3242 |
| 6 | JGI24698J34947_10029700 | 3300002449 | Bacteria | 2887 |
| 7 | Ga0072941_1000318 | 3300005201 | Bacteria | 17818 |
| 8 | Ga0072941_1015277 | 3300005201 | Bacteria | 2513 |
| 9 | Ga0072941_1024066 | 3300005201 | Bacteria | 1983 |
| 10 | Ga0072941_1226138 | 3300005201 | Bacteria | 1811 |
| 11 | Ga0123353_10041131 | 3300010167 | Bacteria | 7298 |
| 12 | Ga0123353_10679409 | 3300010167 | Bacteria | 1450 |
| 13 | Ga0466712_056730 | 3300042614 | Unclassified | 3510 |
| 14 | Ga0466712_084042 | 3300042614 | Bacteria | 1920 |
| 15 | Ga0466712_113057 | 3300042614 | Bacteria | 2326 |
| 16 | Ga0415639_016609 | 3300038395 | Bacteria | 8642 |
| 17 | Ga0466693_364438 | 3300042592 | Bacteria | 1016 |
| 18 | Ga0466694_042514 | 3300042594 | Bacteria | 25116 |
| 19 | Ga0466720_045377 | 3300042607 | Bacteria | 41381 |
| 20 | Ga0466697_003069 | 3300042611 | Bacteria | 1500 |
| 21 | JGI24698J34947_10055684 | 3300002449 | Bacteria | 1969 |
| 22 | JGI24698J34947_10082653 | 3300002449 | Unclassified | 1501 |
| 23 | Ga0072941_1024067 | 3300005201 | Bacteria | 2833 |
| 24 | Ga0072941_1024068 | 3300005201 | Bacteria | 1992 |
| 25 | Ga0072941_1293103 | 3300005201 | Bacteria | 1873 |
| 26 | Ga0466712_171947 | 3300042614 | Bacteria | 1220 |
| 27 | Ga0466718_024708 | 3300042617 | Bacteria | 1474 |
| 28 | JGI24698J34947_10013768 | 3300002449 | Bacteria | 4406 |
| 29 | JGI24698J34947_10024876 | 3300002449 | Bacteria | 3192 |
| 30 | JGI24698J34947_10052177 | 3300002449 | Bacteria | 2053 |
| 31 | JGI24698J34947_10154415 | 3300002449 | Unclassified | 948 |
| 32 | Ga0072941_1011847 | 3300005201 | Bacteria | 41565 |
| 33 | Ga0072941_1024065 | 3300005201 | Unclassified | 3381 |
| 34 | Ga0072941_1192249 | 3300005201 | Archaea | 7840 |
| 35 | Ga0466731_234789 | 3300042622 | Bacteria | 1534 |
| 36 | Ga0466731_355891 | 3300042622 | Bacteria | 4828 |
| 37 | Ga0123357_10209582 | 3300009784 | Bacteria | 2193 |
| 38 | Ga0123356_10000073 | 3300010049 | Bacteria | 106706 |
| 39 | Ga0466712_005865 | 3300042614 | Bacteria | 26501 |
| 40 | Ga0466718_007609 | 3300042617 | Bacteria | 2731 |
| 41 | Ga0466699_172400 | 3300042597 | Bacteria | 1563 |
| 42 | Ga0466699_211444 | 3300042597 | Bacteria | 1764 |
| 43 | JGI24698J34947_10018280 | 3300002449 | Unclassified | 3790 |
| 44 | JGI24698J34947_10080561 | 3300002449 | Bacteria | 1529 |
| 45 | Ga0072941_1046618 | 3300005201 | Bacteria | 1656 |
| 46 | Ga0466731_405126 | 3300042622 | Bacteria | 1366 |
| 47 | Ga0123356_10083522 | 3300010049 | Bacteria | 3026 |
| 48 | Ga0466712_035773 | 3300042614 | Bacteria | 1032 |
| 49 | Ga0415639_174852 | 3300038395 | Bacteria | 1216 |
| 50 | Ga0466699_143611 | 3300042597 | Bacteria | 11418 |
| 51 | Ga0466699_238936 | 3300042597 | Bacteria | 1905 |
| 52 | Ga0466699_296485 | 3300042597 | Bacteria | 3447 |
| 53 | Ga0466720_019008 | 3300042607 | Bacteria | 18978 |
| 54 | Ga0466698_344710 | 3300042610 | Bacteria | 2415 |
| 55 | JGI24698J34947_10078501 | 3300002449 | Bacteria | 1557 |
| 56 | JGI24698J34947_10169048 | 3300002449 | Unclassified | 887 |
| 57 | JGI24695J34938_10022394 | 3300002450 | Bacteria | 3068 |
| 58 | Ga0072941_1017058 | 3300005201 | Bacteria | 18391 |
| 59 | Ga0072941_1029825 | 3300005201 | Bacteria | 5051 |
| 60 | Ga0072941_1065148 | 3300005201 | Bacteria | 3264 |
| 61 | Ga0466731_243320 | 3300042622 | Bacteria | 4506 |
| 62 | Ga0123356_10001385 | 3300010049 | Bacteria | 26877 |
| 63 | Ga0123353_10089624 | 3300010167 | Bacteria | 4952 |
| 64 | Ga0123353_10241233 | 3300010167 | Bacteria | 2808 |
| 65 | Ga0466712_045657 | 3300042614 | Bacteria | 1862 |
| 66 | Ga0466712_052210 | 3300042614 | Bacteria | 1836 |
| 67 | Ga0466718_011860 | 3300042617 | Bacteria | 3541 |
| 68 | Ga0466718_144135 | 3300042617 | Bacteria | 2023 |
| 69 | Ga0264413_146509 | 3300024493 | Bacteria | 2535 |
| 70 | Ga0466693_284844 | 3300042592 | Bacteria | 28082 |
| 71 | Ga0466694_213195 | 3300042594 | Bacteria | 1615 |
| 72 | JGI24698J34947_10060908 | 3300002449 | Bacteria | 1860 |
| 73 | JGI24698J34947_10073512 | 3300002449 | Bacteria | 1631 |
| 74 | JGI24695J34938_10000482 | 3300002450 | Bacteria | 38779 |
| 75 | JGI24695J34938_10004973 | 3300002450 | Bacteria | 8482 |
| 76 | JGI24695J34938_10022311 | 3300002450 | Bacteria | 3076 |
| 77 | Ga0466732_383957 | 3300042656 | Bacteria | 1377 |
| 78 | Ga0123356_10004244 | 3300010049 | Bacteria | 14833 |
| 79 | Ga0123356_10071794 | 3300010049 | Bacteria | 3250 |
| 80 | Ga0123353_10083082 | 3300010167 | Bacteria | 5153 |
| 81 | Ga0466712_128075 | 3300042614 | Bacteria | 17619 |
| 82 | Ga0466718_061796 | 3300042617 | Bacteria | 2493 |
| 83 | Ga0264413_107518 | 3300024493 | Bacteria | 40797 |
| 84 | Ga0466694_308894 | 3300042594 | Bacteria | 1147 |
| 85 | Ga0466699_065829 | 3300042597 | Bacteria | 14339 |
| 86 | JGI24698J34947_10066342 | 3300002449 | Bacteria | 1756 |
| 87 | JGI24695J34938_10022538 | 3300002450 | Unclassified | 3056 |
| 88 | Ga0072941_1059041 | 3300005201 | Bacteria | 1398 |
| 89 | Ga0072941_1111772 | 3300005201 | Bacteria | 2208 |
| 90 | Ga0123356_10010149 | 3300010049 | Bacteria | 9262 |
| 91 | Ga0123356_10711950 | 3300010049 | Bacteria | 1173 |
| 92 | Ga0123353_10184804 | 3300010167 | Unclassified | 3297 |
| 93 | Ga0466712_115774 | 3300042614 | Unclassified | 1241 |
| 94 | Ga0466718_109220 | 3300042617 | Bacteria | 21117 |
| 95 | Ga0466694_391389 | 3300042594 | Bacteria | 2063 |
| 96 | Ga0466699_046007 | 3300042597 | Bacteria | 5692 |
| 97 | Ga0466699_076449 | 3300042597 | Bacteria | 17970 |
| 98 | Ga0466699_243244 | 3300042597 | Bacteria | 7863 |
| 99 | Ga0466717_083268 | 3300042604 | Bacteria | 1373 |
| 100 | Ga0466721_309567 | 3300042608 | Bacteria | 7454 |
| 101 | AustNasuHG_c1000066 | 3300000089 | Bacteria | 28642 |
| 102 | JGI24698J34947_10053115 | 3300002449 | Bacteria | 2029 |
| 103 | JGI24698J34947_10065353 | 3300002449 | Bacteria | 1774 |
| 104 | JGI24698J34947_10106199 | 3300002449 | Bacteria | 1250 |
| 105 | JGI24695J34938_10044835 | 3300002450 | Bacteria | 1965 |
| 106 | Ga0072940_1030110 | 3300005200 | Bacteria | 16965 |
| 107 | Ga0072941_1033305 | 3300005201 | Bacteria | 4313 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.