Protein Family IF00929
Metagenome
Isolate
124
Members
46
Samples
119
Scaffolds
136.85
Avg Length
Representative Sequence
- ID
- 3300002834|JGI24696J40584_12902832|JGI24696J40584_129028323
- Length
- 157 aa
- Sequence
- MIDTKKANNAYKVIIDSNIWISFFIGKSFYSLTKYIRNEQVAVITCNEQLQELTDAFLKPKLQKHIQTNQIAIFFAFLKGVSLIVPIAAIIPLCRDPKDDYLLALSIASKAHYLVTGDADLLDMKQICITKIIKYADFEIIMSHNPNAHFESAVGR*
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
55.6%
Kalotermitidae
20.0%
Unclassified
11.1%
Termopsidae
8.9%
Rhinotermitidae
4.4%
Taxonomy
Archaea
1
Bacteria
110
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2820205024 | Unclassified Planctomycetes Cu122P4bin3 | Isolate | Unclassified |
| 9 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 16 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 19 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 20 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 21 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 22 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 26 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 27 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 28 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 29 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 30 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 31 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 32 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 36 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 37 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 38 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 39 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 40 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 41 | 2740892546 | Fibrobacteria bacterium GUT307 IN01_307 | Isolate | Unclassified |
| 42 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 43 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 44 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 45 | 2820178484 | Unclassified Planctomycetes Th196P3bin110 | Isolate | Unclassified |
| 46 | 2820219087 | Unclassified Ignavibacteria Th196P3bin14 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10307368 | 3300010049 | Bacteria | 1693 |
| 2 | Ga0123356_10846521 | 3300010049 | Unclassified | 1086 |
| 3 | Ga0123354_10622593 | 3300010882 | Bacteria | 782 |
| 4 | Ga0466705_513188 | 3300042612 | Bacteria | 2882 |
| 5 | Ga0466712_096901 | 3300042614 | Bacteria | 12451 |
| 6 | Ga0466715_226451 | 3300042616 | Bacteria | 2519 |
| 7 | Ga0466726_002331 | 3300042619 | Bacteria | 1262 |
| 8 | Ga0466728_389311 | 3300042620 | Bacteria | 12570 |
| 9 | Ga0466716_105585 | 3300042605 | Unclassified | 2240 |
| 10 | Ga0466721_240448 | 3300042608 | Bacteria | 1837 |
| 11 | Ga0466721_391662 | 3300042608 | Unclassified | 1009 |
| 12 | Ga0466698_168289 | 3300042610 | Bacteria | 3256 |
| 13 | Ga0466698_344925 | 3300042610 | Bacteria | 2818 |
| 14 | Ga0466698_396147 | 3300042610 | Bacteria | 1198 |
| 15 | Ga0466703_031828 | 3300042636 | Bacteria | 1056 |
| 16 | Ga0466690_100416 | 3300042590 | Bacteria | 9323 |
| 17 | Ga0466693_201080 | 3300042592 | Bacteria | 2708 |
| 18 | Ga0466693_333925 | 3300042592 | Unclassified | 1054 |
| 19 | Ga0466691_153583 | 3300042593 | Bacteria | 2920 |
| 20 | JGI24698J34947_10033916 | 3300002449 | Bacteria | 2674 |
| 21 | JGI24695J34938_10048387 | 3300002450 | Bacteria | 1873 |
| 22 | JGI24696J40584_12657955 | 3300002834 | Bacteria | 699 |
| 23 | Ga0123353_10583281 | 3300010167 | Bacteria | 1603 |
| 24 | Ga0123353_12727360 | 3300010167 | Bacteria | 581 |
| 25 | Ga0466718_020617 | 3300042617 | Bacteria | 2635 |
| 26 | Ga0466718_062622 | 3300042617 | Bacteria | 1032 |
| 27 | Ga0466721_092680 | 3300042608 | Bacteria | 1392 |
| 28 | Ga0466721_305990 | 3300042608 | Unclassified | 1081 |
| 29 | Ga0466698_223295 | 3300042610 | Bacteria | 1007 |
| 30 | Ga0466731_113360 | 3300042622 | Bacteria | 1125 |
| 31 | Ga0466704_153570 | 3300042643 | Bacteria | 1055 |
| 32 | Ga0466727_303770 | 3300042655 | Bacteria | 4144 |
| 33 | Ga0466691_198409 | 3300042593 | Bacteria | 14467 |
| 34 | Ga0466695_233835 | 3300042595 | Bacteria | 1527 |
| 35 | Ga0072941_1027941 | 3300005201 | Bacteria | 11074 |
| 36 | Ga0123353_10352280 | 3300010167 | Bacteria | 2217 |
| 37 | Ga0466717_023178 | 3300042604 | Bacteria | 2399 |
| 38 | Ga0466717_059706 | 3300042604 | Bacteria | 1656 |
| 39 | Ga0466717_098392 | 3300042604 | Archaea | 1088 |
| 40 | Ga0466735_111674 | 3300042624 | Bacteria | 7170 |
| 41 | Ga0466724_64420 | 3300042649 | Bacteria | 4043 |
| 42 | Ga0466693_158457 | 3300042592 | Bacteria | 1353 |
| 43 | JGI24702J35022_10009697 | 3300002462 | Bacteria | 5402 |
| 44 | Ga0068302_10055615 | 3300005071 | Bacteria | 2574 |
| 45 | Ga0072940_1188368 | 3300005200 | Bacteria | 3099 |
| 46 | Ga0123356_10009834 | 3300010049 | Bacteria | 9424 |
| 47 | Ga0466718_007914 | 3300042617 | Bacteria | 1311 |
| 48 | Ga0466726_437572 | 3300042619 | Unclassified | 1087 |
| 49 | Ga0466717_218259 | 3300042604 | Bacteria | 1297 |
| 50 | Ga0466717_237591 | 3300042604 | Bacteria | 3343 |
| 51 | Ga0466721_050091 | 3300042608 | Bacteria | 1021 |
| 52 | Ga0466721_132119 | 3300042608 | Bacteria | 1513 |
| 53 | Ga0466698_150260 | 3300042610 | Bacteria | 1753 |
| 54 | Ga0466691_025993 | 3300042593 | Bacteria | 4125 |
| 55 | Ga0466695_038835 | 3300042595 | Bacteria | 1414 |
| 56 | JGI24695J34938_10125822 | 3300002450 | Bacteria | 1044 |
| 57 | JGI24702J35022_10568942 | 3300002462 | Bacteria | 699 |
| 58 | Ga0123356_10048605 | 3300010049 | Bacteria | 3948 |
| 59 | Ga0123356_10253869 | 3300010049 | Bacteria | 1838 |
| 60 | Ga0123356_11626718 | 3300010049 | Bacteria | 800 |
| 61 | Ga0123353_11692999 | 3300010167 | Bacteria | 793 |
| 62 | Ga0466715_007547 | 3300042616 | Bacteria | 1797 |
| 63 | Ga0466726_242988 | 3300042619 | Bacteria | 3539 |
| 64 | Ga0466726_424529 | 3300042619 | Bacteria | 3067 |
| 65 | Ga0466717_142782 | 3300042604 | Bacteria | 1392 |
| 66 | Ga0466719_305015 | 3300042606 | Unclassified | 3987 |
| 67 | Ga0466698_294718 | 3300042610 | Bacteria | 1320 |
| 68 | Ga0466727_144302 | 3300042655 | Bacteria | 10770 |
| 69 | Ga0466692_076746 | 3300042591 | Bacteria | 2948 |
| 70 | Ga0466693_333254 | 3300042592 | Bacteria | 1140 |
| 71 | Ga0466699_016003 | 3300042597 | Bacteria | 1153 |
| 72 | JGI24696J40584_12902832 | 3300002834 | Bacteria | 1197 |
| 73 | Ga0072941_1084664 | 3300005201 | Bacteria | 4019 |
| 74 | Ga0466697_278613 | 3300042611 | Unclassified | 1229 |
| 75 | Ga0123353_10040896 | 3300010167 | Bacteria | 7317 |
| 76 | Ga0466734_154750 | 3300042623 | Unclassified | 1382 |
| 77 | Ga0466703_113467 | 3300042636 | Bacteria | 2478 |
| 78 | Ga0466725_350652 | 3300042654 | Bacteria | 1031 |
| 79 | Ga0466695_151719 | 3300042595 | Bacteria | 1202 |
| 80 | Ga0466695_289450 | 3300042595 | Bacteria | 1552 |
| 81 | Ga0466699_140439 | 3300042597 | Bacteria | 1415 |
| 82 | JGI24702J35022_10304202 | 3300002462 | Bacteria | 942 |
| 83 | Ga0072941_1016274 | 3300005201 | Bacteria | 55486 |
| 84 | Ga0466732_396770 | 3300042656 | Bacteria | 4275 |
| 85 | Ga0123356_10276204 | 3300010049 | Bacteria | 1773 |
| 86 | Ga0123356_10413787 | 3300010049 | Bacteria | 1489 |
| 87 | Ga0123356_10420811 | 3300010049 | Bacteria | 1478 |
| 88 | Ga0123356_10731857 | 3300010049 | Bacteria | 1159 |
| 89 | Ga0123356_10751012 | 3300010049 | Bacteria | 1146 |
| 90 | Ga0123353_10184247 | 3300010167 | Unclassified | 3302 |
| 91 | Ga0123353_10582897 | 3300010167 | Bacteria | 1604 |
| 92 | Ga0466712_182736 | 3300042614 | Bacteria | 1166 |
| 93 | Ga0466728_042808 | 3300042620 | Bacteria | 1098 |
| 94 | Ga0466721_337117 | 3300042608 | Bacteria | 1043 |
| 95 | Ga0466698_482839 | 3300042610 | Bacteria | 2401 |
| 96 | Ga0466729_231712 | 3300042621 | Bacteria | 1363 |
| 97 | Ga0466735_007507 | 3300042624 | Bacteria | 1669 |
| 98 | Ga0466695_089485 | 3300042595 | Bacteria | 1780 |
| 99 | Ga0466699_256582 | 3300042597 | Bacteria | 1325 |
| 100 | JGI24702J35022_10034930 | 3300002462 | Bacteria | 2689 |
| 101 | JGI24705J35276_12235253 | 3300002504 | Bacteria | 6337 |
| 102 | Ga0072940_1367904 | 3300005200 | Bacteria | 1347 |
| 103 | Ga0466705_070516 | 3300042612 | Unclassified | 1593 |
| 104 | Ga0466705_272557 | 3300042612 | Bacteria | 2386 |
| 105 | Ga0123356_11227414 | 3300010049 | Bacteria | 915 |
| 106 | Ga0123353_10474147 | 3300010167 | Unclassified | 1833 |
| 107 | Ga0123353_11605419 | 3300010167 | Bacteria | 821 |
| 108 | Ga0466710_132024 | 3300042613 | Bacteria | 1235 |
| 109 | Ga0466715_515313 | 3300042616 | Bacteria | 2308 |
| 110 | Ga0466718_012503 | 3300042617 | Bacteria | 21087 |
| 111 | Ga0466701_031191 | 3300042598 | Bacteria | 1057 |
| 112 | Ga0466707_185784 | 3300042601 | Bacteria | 5351 |
| 113 | Ga0466717_202413 | 3300042604 | Unclassified | 2409 |
| 114 | Ga0466698_312820 | 3300042610 | Bacteria | 1146 |
| 115 | Ga0466731_401005 | 3300042622 | Bacteria | 1088 |
| 116 | Ga0466699_113010 | 3300042597 | Bacteria | 1541 |
| 117 | JGI24695J34938_10152897 | 3300002450 | Bacteria | 946 |
| 118 | JGI24696J40584_12782405 | 3300002834 | Bacteria | 838 |
| 119 | JGI24696J40584_12941027 | 3300002834 | Bacteria | 1695 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13470 | PIN_3 | PIN domain | 12 | 119 | 0.88 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.