Protein Family IF00720
Metagenome
Isolate
110
Members
43
Samples
108
Scaffolds
101.18
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10145117|JGI24695J34938_101451171
- Length
- 122 aa
- Sequence
- VLLKPLDKLLNIFYTKKTMKKKIRNSDTFDNWFGKLHDKRAIAKIAARIDRLAEGNPGDVEPIGEGCSELRIHFGPGYRVYYKDAGREIILLLCGGDKSTQQKDINKALEIARFYEEGARI*
Sample Types
Isolate
1.8%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
56.1%
Kalotermitidae
14.6%
Termopsidae
9.8%
Unclassified
7.3%
Rhinotermitidae
4.9%
Formicidae
4.9%
Plutellidae
2.4%
Taxonomy
Archaea
0
Bacteria
95
Eukaryota
0
Viruses
0
Unclassified
15
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 4 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 5 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 6 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 7 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 8 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 9 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 10 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 11 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 12 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 13 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 14 | 3300007142 | Ant gut microbial communities from Cephalotes grandinosus, Brazil | Metagenome | Formicidae |
| 15 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 18 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 19 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 20 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 21 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 3300035364 | Gut microbial communities from Plutella xylostella in Fujian, Fuzhou, China - adult gut | Metagenome | Plutellidae |
| 26 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 27 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 28 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 29 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 30 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 31 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 32 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 33 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 34 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 35 | 3300007190 | Ant gut microbial communities from Cephalotes umbraculatus, Peru | Metagenome | Formicidae |
| 36 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 37 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 38 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 39 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 40 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 41 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 42 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 43 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466700_473000 | 3300042600 | Bacteria | 1153 |
| 2 | Ga0466722_132811 | 3300042609 | Bacteria | 2038 |
| 3 | Ga0466718_124279 | 3300042617 | Bacteria | 1651 |
| 4 | JGI24698J34947_10016098 | 3300002449 | Unclassified | 4063 |
| 5 | JGI24698J34947_10093733 | 3300002449 | Bacteria | 1370 |
| 6 | JGI24698J34947_10151614 | 3300002449 | Bacteria | 962 |
| 7 | Ga0068302_10313186 | 3300005071 | Bacteria | 512 |
| 8 | Ga0072941_1047486 | 3300005201 | Bacteria | 1129 |
| 9 | Ga0466700_126556 | 3300042600 | Bacteria | 1187 |
| 10 | Ga0466713_060579 | 3300042602 | Bacteria | 62557 |
| 11 | Ga0466717_024804 | 3300042604 | Bacteria | 1722 |
| 12 | Ga0466717_055027 | 3300042604 | Unclassified | 1166 |
| 13 | Ga0466720_140096 | 3300042607 | Bacteria | 3612 |
| 14 | Ga0466718_144469 | 3300042617 | Bacteria | 1176 |
| 15 | Ga0466726_036173 | 3300042619 | Bacteria | 4497 |
| 16 | Ga0466726_238905 | 3300042619 | Bacteria | 2104 |
| 17 | Ga0415639_121348 | 3300038395 | Bacteria | 7551 |
| 18 | Ga0466694_365714 | 3300042594 | Unclassified | 1094 |
| 19 | Ga0466731_084583 | 3300042622 | Bacteria | 1094 |
| 20 | Ga0466735_039564 | 3300042624 | Bacteria | 1120 |
| 21 | Ga0466732_098449 | 3300042656 | Bacteria | 1276 |
| 22 | Ga0466732_109614 | 3300042656 | Bacteria | 5215 |
| 23 | JGI24698J34947_10115761 | 3300002449 | Bacteria | 1174 |
| 24 | JGI24695J34938_10145117 | 3300002450 | Bacteria | 971 |
| 25 | JGI24697J35500_11274865 | 3300002507 | Bacteria | 10961 |
| 26 | Ga0072940_1029961 | 3300005200 | Bacteria | 1220 |
| 27 | Ga0103267_1000303 | 3300007190 | Bacteria | 17456 |
| 28 | Ga0466705_399347 | 3300042612 | Bacteria | 1507 |
| 29 | Ga0466718_046914 | 3300042617 | Bacteria | 2626 |
| 30 | Ga0466718_141118 | 3300042617 | Bacteria | 2111 |
| 31 | Ga0466726_310541 | 3300042619 | Bacteria | 1009 |
| 32 | Ga0466696_092787 | 3300042596 | Bacteria | 2351 |
| 33 | Ga0466731_246082 | 3300042622 | Bacteria | 4169 |
| 34 | Ga0466730_042171 | 3300042625 | Unclassified | 17569 |
| 35 | Ga0466732_149074 | 3300042656 | Bacteria | 1079 |
| 36 | Ga0123356_10766272 | 3300010049 | Bacteria | 1135 |
| 37 | Ga0123353_10282216 | 3300010167 | Bacteria | 2550 |
| 38 | JGI24698J34947_10008378 | 3300002449 | Bacteria | 5674 |
| 39 | JGI24698J34947_10030867 | 3300002449 | Bacteria | 2824 |
| 40 | JGI24698J34947_10206916 | 3300002449 | Bacteria | 764 |
| 41 | JGI24695J34938_10274694 | 3300002450 | Bacteria | 721 |
| 42 | Ga0072941_1004171 | 3300005201 | Bacteria | 25127 |
| 43 | Ga0466719_037019 | 3300042606 | Unclassified | 1143 |
| 44 | Ga0466722_162344 | 3300042609 | Bacteria | 1607 |
| 45 | Ga0466712_053160 | 3300042614 | Bacteria | 1531 |
| 46 | Ga0466715_006294 | 3300042616 | Bacteria | 2065 |
| 47 | Ga0466718_013314 | 3300042617 | Bacteria | 1205 |
| 48 | Ga0466718_054045 | 3300042617 | Bacteria | 19690 |
| 49 | Ga0466718_112170 | 3300042617 | Bacteria | 2235 |
| 50 | Ga0264413_118346 | 3300024493 | Bacteria | 2380 |
| 51 | Ga0247290_03409 | 3300035364 | Bacteria | 1261 |
| 52 | Ga0466692_134625 | 3300042591 | Bacteria | 1675 |
| 53 | Ga0466732_041457 | 3300042656 | Bacteria | 6296 |
| 54 | JGI24698J34947_10326903 | 3300002449 | Unclassified | 544 |
| 55 | JGI24695J34938_10017774 | 3300002450 | Bacteria | 3572 |
| 56 | JGI24702J35022_11043350 | 3300002462 | Bacteria | 508 |
| 57 | Ga0466712_108545 | 3300042614 | Bacteria | 3255 |
| 58 | Ga0466726_057285 | 3300042619 | Bacteria | 3651 |
| 59 | Ga0466728_141775 | 3300042620 | Bacteria | 2964 |
| 60 | Ga0264413_134002 | 3300024493 | Bacteria | 6040 |
| 61 | Ga0466694_197838 | 3300042594 | Bacteria | 4946 |
| 62 | Ga0466704_175411 | 3300042643 | Unclassified | 1812 |
| 63 | Ga0123356_11893565 | 3300010049 | Bacteria | 742 |
| 64 | Ga0123353_10745748 | 3300010167 | Bacteria | 1364 |
| 65 | Ga0123354_10168369 | 3300010882 | Unclassified | 2563 |
| 66 | JGI24698J34947_10046361 | 3300002449 | Bacteria | 2211 |
| 67 | JGI24698J34947_10353303 | 3300002449 | Unclassified | 514 |
| 68 | JGI24695J34938_10013486 | 3300002450 | Bacteria | 4290 |
| 69 | JGI24696J40584_12799344 | 3300002834 | Bacteria | 866 |
| 70 | Ga0072940_1121238 | 3300005200 | Bacteria | 1234 |
| 71 | Ga0466720_110415 | 3300042607 | Bacteria | 16866 |
| 72 | Ga0466712_079676 | 3300042614 | Bacteria | 5076 |
| 73 | Ga0466718_099471 | 3300042617 | Bacteria | 3012 |
| 74 | Ga0466718_116695 | 3300042617 | Bacteria | 6017 |
| 75 | Ga0466694_246004 | 3300042594 | Unclassified | 2648 |
| 76 | Ga0466695_006657 | 3300042595 | Bacteria | 38064 |
| 77 | Ga0466699_299229 | 3300042597 | Bacteria | 1361 |
| 78 | Ga0466727_345392 | 3300042655 | Bacteria | 1137 |
| 79 | Ga0466705_366247 | 3300042612 | Bacteria | 1310 |
| 80 | Ga0466732_114871 | 3300042656 | Bacteria | 3083 |
| 81 | Ga0123356_13337444 | 3300010049 | Unclassified | 558 |
| 82 | Ga0123353_13326114 | 3300010167 | Bacteria | 512 |
| 83 | JGI24698J34947_10177121 | 3300002449 | Unclassified | 856 |
| 84 | JGI24695J34938_10145057 | 3300002450 | Bacteria | 971 |
| 85 | JGI24702J35022_10406004 | 3300002462 | Bacteria | 823 |
| 86 | Ga0102737_1016849 | 3300007142 | Unclassified | 1157 |
| 87 | Ga0466720_172730 | 3300042607 | Bacteria | 3349 |
| 88 | Ga0466721_118422 | 3300042608 | Bacteria | 3416 |
| 89 | Ga0466712_021217 | 3300042614 | Bacteria | 23153 |
| 90 | Ga0466712_202956 | 3300042614 | Bacteria | 1418 |
| 91 | Ga0466712_263842 | 3300042614 | Bacteria | 2670 |
| 92 | Ga0466718_014436 | 3300042617 | Bacteria | 2241 |
| 93 | Ga0466718_050290 | 3300042617 | Bacteria | 1154 |
| 94 | Ga0466726_054188 | 3300042619 | Bacteria | 1015 |
| 95 | Ga0264413_115425 | 3300024493 | Unclassified | 1236 |
| 96 | Ga0415639_063289 | 3300038395 | Bacteria | 3071 |
| 97 | Ga0466694_134714 | 3300042594 | Bacteria | 1198 |
| 98 | Ga0466694_242042 | 3300042594 | Bacteria | 2041 |
| 99 | Ga0466699_100447 | 3300042597 | Bacteria | 1506 |
| 100 | Ga0466727_339106 | 3300042655 | Bacteria | 2953 |
| 101 | JGI24705J35276_11811639 | 3300002504 | Bacteria | 691 |
| 102 | Ga0466721_175063 | 3300042608 | Bacteria | 1337 |
| 103 | Ga0466722_239716 | 3300042609 | Bacteria | 1285 |
| 104 | Ga0466712_003183 | 3300042614 | Unclassified | 2854 |
| 105 | Ga0466718_058451 | 3300042617 | Bacteria | 1370 |
| 106 | Ga0466718_163949 | 3300042617 | Bacteria | 8784 |
| 107 | Ga0264413_112248 | 3300024493 | Bacteria | 2752 |
| 108 | Ga0466699_070342 | 3300042597 | Bacteria | 4102 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05973 | Gp49 | Phage derived protein Gp49-like (DUF891) | 32 | 112 | 0.77 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.