Protein Family IF00697
Metagenome
Isolate
125
Members
39
Samples
120
Scaffolds
469.82
Avg Length
Representative Sequence
- ID
- 3300002450|JGI24695J34938_10038037|JGI24695J34938_100380372
- Length
- 472 aa
- Sequence
- MDISFYSLGAAEEVTGSKHVIEIDGKSYLIDCGAFQGRRAEANEKNRKFGIAADKIEAAILTHGHYDHCGLLPLLVKNGYTGNIYATPASRDIASLIMMDSANIQARDAEYLRKQAKKKGEKFDWEPLYSEKDAIAATSQFLGVSYNRPIHISSDVKLEFFDAGHILGSALVMLTAKKDGKEVNILATGDLGRKGKPIIRDPATKTPPPDYIILESTYGDRLHENAEAAFDKLAEITQRMVKKRGKILIPAFAIERTQELVYYFHLLVDEGIIPEIPIFVDSPMATNATTIYQVHPECYGEEIKAAFIKHHKNPFGFNALHFTSSVTESKALNSRPGPFIIISADGMCEAGRIQHHLIHXIGDPNTTILTVGYMAQHTLGRRIRDKATEVXIHGMTLKRRAAVEEVNAFSAHADYAEATGWLKALDTSRLKTIFLVHGEPKAQSAFRKHLIGSGFPNVEIVKYGDVYNLNG*
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.9%
Termitidae
35.9%
Unclassified
15.4%
Rhinotermitidae
7.7%
Termopsidae
5.1%
Taxonomy
Archaea
0
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 5 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 8 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 9 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 10 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 11 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 12 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 13 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 14 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 15 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 16 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 17 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 18 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 19 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 32 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 33 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 34 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 35 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 36 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 37 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10000062 | 3300002449 | Bacteria | 33537 |
| 2 | Ga0466696_038234 | 3300042596 | Bacteria | 10450 |
| 3 | Ga0466696_039136 | 3300042596 | Bacteria | 3571 |
| 4 | Ga0466696_100942 | 3300042596 | Bacteria | 13778 |
| 5 | Ga0466696_483735 | 3300042596 | Bacteria | 5647 |
| 6 | Ga0466703_105319 | 3300042636 | Bacteria | 11490 |
| 7 | Ga0466703_333259 | 3300042636 | Bacteria | 21872 |
| 8 | Ga0466703_394768 | 3300042636 | Bacteria | 12728 |
| 9 | Ga0466704_264950 | 3300042643 | Bacteria | 2671 |
| 10 | Ga0466708_160776 | 3300042652 | Bacteria | 7921 |
| 11 | Ga0466715_015169 | 3300042616 | Bacteria | 13317 |
| 12 | Ga0123357_10047596 | 3300009784 | Bacteria | 5811 |
| 13 | JGI24698J34947_10005137 | 3300002449 | Bacteria | 7171 |
| 14 | JGI24698J34947_10020384 | 3300002449 | Bacteria | 3571 |
| 15 | Ga0466690_308869 | 3300042590 | Bacteria | 2732 |
| 16 | Ga0466692_082745 | 3300042591 | Bacteria | 4359 |
| 17 | Ga0466691_157463 | 3300042593 | Bacteria | 7532 |
| 18 | Ga0466704_553586 | 3300042643 | Bacteria | 8283 |
| 19 | Ga0466709_184677 | 3300042648 | Bacteria | 6455 |
| 20 | Ga0466708_185260 | 3300042652 | Bacteria | 27851 |
| 21 | Ga0466708_309923 | 3300042652 | Bacteria | 15251 |
| 22 | Ga0466705_478322 | 3300042612 | Bacteria | 2750 |
| 23 | Ga0466711_140753 | 3300042615 | Bacteria | 2134 |
| 24 | Ga0466718_027167 | 3300042617 | Bacteria | 2021 |
| 25 | Ga0466726_375457 | 3300042619 | Bacteria | 4528 |
| 26 | Ga0466728_115466 | 3300042620 | Bacteria | 2335 |
| 27 | Ga0466705_090456 | 3300042612 | Bacteria | 5959 |
| 28 | Ga0466716_045202 | 3300042605 | Bacteria | 7053 |
| 29 | Ga0466719_045159 | 3300042606 | Bacteria | 3033 |
| 30 | Ga0466719_209838 | 3300042606 | Bacteria | 13035 |
| 31 | Ga0466722_127491 | 3300042609 | Bacteria | 4581 |
| 32 | Ga0466690_140903 | 3300042590 | Bacteria | 4746 |
| 33 | Ga0466691_048192 | 3300042593 | Bacteria | 4096 |
| 34 | Ga0466703_146211 | 3300042636 | Bacteria | 3038 |
| 35 | Ga0466703_427125 | 3300042636 | Bacteria | 22449 |
| 36 | Ga0466704_052200 | 3300042643 | Bacteria | 11935 |
| 37 | Ga0466727_337447 | 3300042655 | Bacteria | 7717 |
| 38 | Ga0466712_060125 | 3300042614 | Bacteria | 2052 |
| 39 | Ga0466723_072096 | 3300042618 | Bacteria | 8728 |
| 40 | Ga0466728_020291 | 3300042620 | Bacteria | 11173 |
| 41 | Ga0123353_10116452 | 3300010167 | Bacteria | 4300 |
| 42 | Ga0123354_10211361 | 3300010882 | Bacteria | 2095 |
| 43 | JGI24702J35022_10014153 | 3300002462 | Bacteria | 4405 |
| 44 | JGI24702J35022_10019251 | 3300002462 | Bacteria | 3713 |
| 45 | Ga0466692_058889 | 3300042591 | Bacteria | 41705 |
| 46 | Ga0466693_376574 | 3300042592 | Bacteria | 10876 |
| 47 | Ga0466691_030035 | 3300042593 | Bacteria | 13573 |
| 48 | Ga0466694_151076 | 3300042594 | Bacteria | 2145 |
| 49 | Ga0466712_135877 | 3300042614 | Bacteria | 43910 |
| 50 | Ga0466718_107737 | 3300042617 | Bacteria | 57891 |
| 51 | Ga0466723_218986 | 3300042618 | Bacteria | 5605 |
| 52 | Ga0466728_283116 | 3300042620 | Bacteria | 14972 |
| 53 | Ga0466705_238128 | 3300042612 | Bacteria | 14245 |
| 54 | Ga0466705_384625 | 3300042612 | Bacteria | 2289 |
| 55 | Ga0466707_409540 | 3300042601 | Bacteria | 1740 |
| 56 | Ga0466716_303248 | 3300042605 | Bacteria | 7783 |
| 57 | Ga0466719_045829 | 3300042606 | Bacteria | 7595 |
| 58 | Ga0123357_10010795 | 3300009784 | Bacteria | 11653 |
| 59 | Ga0123356_10152424 | 3300010049 | Bacteria | 2297 |
| 60 | Ga0123353_10243438 | 3300010167 | Bacteria | 2792 |
| 61 | Ga0415639_085203 | 3300038395 | Bacteria | 6061 |
| 62 | Ga0466691_092917 | 3300042593 | Bacteria | 16380 |
| 63 | Ga0466694_244595 | 3300042594 | Bacteria | 2088 |
| 64 | Ga0466696_027634 | 3300042596 | Bacteria | 23130 |
| 65 | Ga0466696_342909 | 3300042596 | Bacteria | 12307 |
| 66 | Ga0466704_058484 | 3300042643 | Bacteria | 10605 |
| 67 | Ga0466704_170992 | 3300042643 | Unclassified | 6876 |
| 68 | Ga0466709_049864 | 3300042648 | Bacteria | 4339 |
| 69 | Ga0466709_116657 | 3300042648 | Bacteria | 9050 |
| 70 | Ga0466712_060985 | 3300042614 | Bacteria | 1477 |
| 71 | Ga0466705_102753 | 3300042612 | Unclassified | 3244 |
| 72 | Ga0466707_357899 | 3300042601 | Bacteria | 2127 |
| 73 | Ga0466716_224053 | 3300042605 | Bacteria | 6035 |
| 74 | Ga0466719_457762 | 3300042606 | Bacteria | 12202 |
| 75 | Ga0123353_10217159 | 3300010167 | Bacteria | 2994 |
| 76 | Ga0123353_10247360 | 3300010167 | Bacteria | 2765 |
| 77 | Ga0123353_10372199 | 3300010167 | Bacteria | 2141 |
| 78 | JGI24702J35022_10036995 | 3300002462 | Bacteria | 2608 |
| 79 | Ga0466694_401871 | 3300042594 | Bacteria | 8423 |
| 80 | Ga0466695_406261 | 3300042595 | Bacteria | 8431 |
| 81 | Ga0466699_003870 | 3300042597 | Bacteria | 6783 |
| 82 | Ga0466703_365703 | 3300042636 | Bacteria | 3026 |
| 83 | Ga0466704_480269 | 3300042643 | Bacteria | 7058 |
| 84 | Ga0466709_093376 | 3300042648 | Bacteria | 8279 |
| 85 | Ga0466712_053470 | 3300042614 | Bacteria | 21567 |
| 86 | Ga0466711_273382 | 3300042615 | Bacteria | 13808 |
| 87 | Ga0466715_266587 | 3300042616 | Bacteria | 13713 |
| 88 | Ga0466715_271739 | 3300042616 | Bacteria | 19479 |
| 89 | Ga0466723_314266 | 3300042618 | Bacteria | 2896 |
| 90 | Ga0466723_318382 | 3300042618 | Bacteria | 7015 |
| 91 | Ga0466728_258477 | 3300042620 | Bacteria | 15917 |
| 92 | Ga0466729_135712 | 3300042621 | Bacteria | 2409 |
| 93 | JGI24698J34947_10002456 | 3300002449 | Bacteria | 9994 |
| 94 | JGI24695J34938_10038037 | 3300002450 | Bacteria | 2181 |
| 95 | JGI24702J35022_10000471 | 3300002462 | Bacteria | 24271 |
| 96 | Ga0466690_381369 | 3300042590 | Bacteria | 3917 |
| 97 | Ga0466703_001130 | 3300042636 | Bacteria | 12075 |
| 98 | Ga0466703_173126 | 3300042636 | Bacteria | 3253 |
| 99 | Ga0466704_127033 | 3300042643 | Bacteria | 3075 |
| 100 | Ga0466704_264549 | 3300042643 | Bacteria | 13510 |
| 101 | Ga0466708_122619 | 3300042652 | Bacteria | 14870 |
| 102 | Ga0466708_239688 | 3300042652 | Bacteria | 4777 |
| 103 | Ga0466715_376037 | 3300042616 | Bacteria | 6156 |
| 104 | Ga0466715_416570 | 3300042616 | Bacteria | 4263 |
| 105 | Ga0466723_051587 | 3300042618 | Bacteria | 6859 |
| 106 | Ga0466728_033874 | 3300042620 | Bacteria | 17572 |
| 107 | Ga0466728_100704 | 3300042620 | Bacteria | 2209 |
| 108 | Ga0466729_118870 | 3300042621 | Bacteria | 2754 |
| 109 | Ga0466705_093439 | 3300042612 | Bacteria | 8984 |
| 110 | Ga0123353_10236946 | 3300010167 | Bacteria | 2839 |
| 111 | Ga0123354_10109433 | 3300010882 | Bacteria | 3661 |
| 112 | JGI24698J34947_10003697 | 3300002449 | Bacteria | 8322 |
| 113 | Ga0466694_097362 | 3300042594 | Bacteria | 3291 |
| 114 | Ga0466696_108645 | 3300042596 | Bacteria | 3065 |
| 115 | Ga0466704_017222 | 3300042643 | Bacteria | 5650 |
| 116 | Ga0466709_334003 | 3300042648 | Bacteria | 9072 |
| 117 | Ga0466708_082196 | 3300042652 | Bacteria | 10790 |
| 118 | Ga0466723_126281 | 3300042618 | Bacteria | 6517 |
| 119 | Ga0466723_344729 | 3300042618 | Bacteria | 2098 |
| 120 | Ga0466726_363216 | 3300042619 | Bacteria | 1922 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF10996 | Beta-Casp | Beta-Casp domain | 257 | 383 | 0.99 |
| PF07521 | RMMBL | Zn-dependent metallo-hydrolase RNA specificity domain | 397 | 454 | 0.91 |
| PF00753 | Lactamase_B | Metallo-beta-lactamase superfamily | 20 | 85 | 0.9 |
| PF16661 | Lactamase_B_6 | Metallo-beta-lactamase superfamily domain | 21 | 178 | 0.83 |
| PF12706 | Lactamase_B_2 | Beta-lactamase superfamily domain | 28 | 90 | 0.71 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.