Protein Family IF00616

Metagenome Isolate
142 Members
40 Samples
126 Scaffolds
270.01 Avg Length

🧬 Representative Sequence

ID
3300002450|JGI24695J34938_10002891|JGI24695J34938_100028916
Length
305 aa
Sequence
MKRVFFMRKIYLTIIAAYKGVAENMQGFFDALLNINFPFLRNALLAGLLSSVLFXXXGSIVTVRRIGSLAGAISHAVLGGIGMALYLSATIIPGFPPIAGALIFAVLSAIVIGLVSLKAKQREDTVINAIWVIGMSLGLLFMAKTPGYADPSTWLFGNILLISKMDLILLAVLDVIVMLLAWRFYPQIEASSFDAEFARTRGVPVDKIFLLLLGLTAVAIVLLQTFVGIVMVIAILTLPSGCAASFSRNLGSMMISSCLFAGIFSVTGLISGWLFDLPVGAMTVIIAGIVFLGFSVFKAIRKSD*

📊 Sample Types

Isolate 11.3%
Metagenome 88.7%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.7%
Unclassified 42.1%
Kalotermitidae 7.9%
Rhinotermitidae 5.3%

🌳 Taxonomy

Archaea 0
Bacteria 122
Eukaryota 0
Viruses 0
Unclassified 20

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125634 Treponema sp. Co191P1bin45 Isolate Unclassified
2 2781125681 Treponema sp. Lab288P1bin11 Isolate Unclassified
3 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
4 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
5 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
6 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
7 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
8 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
9 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
10 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
14 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
15 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
16 2781125638 Treponema sp. Co191P1bin8 Isolate Unclassified
17 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
20 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
21 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
22 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
23 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
24 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
25 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
26 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
27 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
28 2781125643 Treponema sp. Co191P3bin45 Isolate Unclassified
29 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
30 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
31 2781125651 Treponema sp. Co191P3bin8 Isolate Unclassified
32 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
33 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
34 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
35 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
36 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
37 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
38 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
39 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
40 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_038272 3300042612 Bacteria 31317
2 Ga0466712_001546 3300042614 Bacteria 2593
3 Ga0466712_075027 3300042614 Bacteria 25514
4 Ga0466712_119209 3300042614 Bacteria 10351
5 Ga0466712_166313 3300042614 Bacteria 3070
6 Ga0466712_222188 3300042614 Bacteria 1906
7 Ga0466694_128553 3300042594 Bacteria 11069
8 Ga0466694_212689 3300042594 Bacteria 44215
9 Ga0123356_10001885 3300010049 Bacteria 22734
10 Ga0123356_10018547 3300010049 Bacteria 6604
11 JGI24698J34947_10008876 3300002449 Bacteria 5517
12 JGI24698J34947_10021625 3300002449 Unclassified 3456
13 JGI24698J34947_10027684 3300002449 Unclassified 3006
14 JGI24698J34947_10122589 3300002449 Bacteria 1125
15 JGI24695J34938_10001073 3300002450 Bacteria 24681
16 JGI24695J34938_10001911 3300002450 Bacteria 16835
17 JGI24695J34938_10004600 3300002450 Bacteria 8974
18 JGI24695J34938_10008156 3300002450 Bacteria 6018
19 Ga0072941_1013569 3300005201 Bacteria 19449
20 Ga0072941_1017371 3300005201 Bacteria 7437
21 Ga0466717_169513 3300042604 Bacteria 3953
22 Ga0466716_245689 3300042605 Bacteria 9666
23 Ga0466722_008077 3300042609 Bacteria 6296
24 Ga0466712_049231 3300042614 Bacteria 3655
25 Ga0466712_133776 3300042614 Bacteria 9567
26 Ga0466694_353745 3300042594 Bacteria 1678
27 Ga0123356_10001149 3300010049 Bacteria 29280
28 JGI24695J34938_10000609 3300002450 Bacteria 34314
29 JGI24695J34938_10001935 3300002450 Bacteria 16679
30 JGI24699J35502_11066540 3300002509 Bacteria 1795
31 Ga0072941_1071791 3300005201 Bacteria 4729
32 Ga0466701_026092 3300042598 Bacteria 1882
33 Ga0466712_003047 3300042614 Bacteria 4411
34 Ga0466712_250279 3300042614 Bacteria 6193
35 Ga0466693_084313 3300042592 Bacteria 21473
36 Ga0466694_056888 3300042594 Bacteria 4114
37 Ga0466694_404495 3300042594 Unclassified 1616
38 JGI24698J34947_10002691 3300002449 Bacteria 9595
39 JGI24698J34947_10123374 3300002449 Bacteria 1120
40 JGI24695J34938_10001117 3300002450 Bacteria 24194
41 JGI24695J34938_10019992 3300002450 Bacteria 3304
42 JGI24695J34938_10043829 3300002450 Bacteria 1993
43 Ga0466712_123782 3300042614 Unclassified 5310
44 Ga0466694_026146 3300042594 Unclassified 3317
45 Ga0466695_218867 3300042595 Bacteria 114312
46 Ga0123356_10013165 3300010049 Bacteria 7999
47 Ga0123356_10315348 3300010049 Bacteria 1675
48 JGI24698J34947_10011300 3300002449 Unclassified 4901
49 JGI24698J34947_10040636 3300002449 Unclassified 2400
50 JGI24698J34947_10051844 3300002449 Bacteria 2061
51 JGI24695J34938_10001005 3300002450 Bacteria 25623
52 JGI24695J34938_10001739 3300002450 Bacteria 18011
53 Ga0072941_1002115 3300005201 Bacteria 15173
54 Ga0072941_1015922 3300005201 Bacteria 7905
55 Ga0072941_1021425 3300005201 Unclassified 4851
56 Ga0466722_005079 3300042609 Bacteria 9676
57 Ga0466698_121989 3300042610 Bacteria 11045
58 Ga0466712_156386 3300042614 Unclassified 1137
59 Ga0466712_188603 3300042614 Bacteria 7742
60 Ga0466718_072044 3300042617 Unclassified 4561
61 Ga0466718_080262 3300042617 Bacteria 12317
62 Ga0415639_000613 3300038395 Bacteria 6710
63 Ga0123356_10000059 3300010049 Bacteria 117133
64 Ga0123356_10054351 3300010049 Bacteria 3730
65 JGI24698J34947_10011649 3300002449 Bacteria 4828
66 JGI24695J34938_10000099 3300002450 Bacteria 75735
67 JGI24695J34938_10000596 3300002450 Bacteria 34787
68 JGI24695J34938_10000790 3300002450 Bacteria 29511
69 JGI24695J34938_10002491 3300002450 Bacteria 14028
70 JGI24695J34938_10005703 3300002450 Bacteria 7686
71 JGI24699J35502_11107944 3300002509 Unclassified 2577
72 Ga0072941_1003686 3300005201 Bacteria 12667
73 Ga0466722_122077 3300042609 Bacteria 1367
74 Ga0466712_011481 3300042614 Bacteria 16833
75 Ga0466712_247924 3300042614 Bacteria 11509
76 Ga0466712_297686 3300042614 Bacteria 8137
77 Ga0466718_003908 3300042617 Unclassified 3267
78 Ga0415639_260901 3300038395 Bacteria 1153
79 Ga0466690_131379 3300042590 Bacteria 17000
80 Ga0466693_124274 3300042592 Bacteria 1384
81 Ga0466694_109381 3300042594 Bacteria 7547
82 Ga0466694_293395 3300042594 Bacteria 2545
83 Ga0123356_10054138 3300010049 Bacteria 3737
84 Ga0123356_10435426 3300010049 Bacteria 1456
85 AustNasuHG_c1000386 3300000089 Bacteria 15293
86 JGI24698J34947_10015335 3300002449 Unclassified 4172
87 JGI24695J34938_10001543 3300002450 Bacteria 19410
88 JGI24695J34938_10001659 3300002450 Bacteria 18490
89 JGI24695J34938_10010183 3300002450 Bacteria 5175
90 Ga0072941_1020792 3300005201 Bacteria 5298
91 Ga0466720_032562 3300042607 Bacteria 37928
92 Ga0466712_000965 3300042614 Bacteria 3920
93 Ga0466718_008574 3300042617 Bacteria 15835
94 Ga0264413_132675 3300024493 Bacteria 4183
95 Ga0415639_015185 3300038395 Bacteria 11060
96 Ga0466699_318623 3300042597 Bacteria 8731
97 Ga0123356_10009178 3300010049 Bacteria 9777
98 Ga0123356_10642036 3300010049 Bacteria 1228
99 JGI24698J34947_10000090 3300002449 Bacteria 30429
100 JGI24698J34947_10003292 3300002449 Bacteria 8753
101 JGI24698J34947_10008362 3300002449 Unclassified 5680
102 JGI24698J34947_10044820 3300002449 Unclassified 2261
103 JGI24695J34938_10002891 3300002450 Bacteria 12490
104 JGI24695J34938_10007341 3300002450 Bacteria 6475
105 JGI24695J34938_10007811 3300002450 Unclassified 6197
106 JGI24695J34938_10008569 3300002450 Unclassified 5816
107 JGI24695J34938_10029023 3300002450 Bacteria 2591
108 Ga0466714_147426 3300042603 Bacteria 1337
109 Ga0466717_074013 3300042604 Unclassified 1702
110 Ga0466722_059910 3300042609 Bacteria 4746
111 Ga0466712_207799 3300042614 Bacteria 2220
112 Ga0466712_248455 3300042614 Unclassified 4651
113 Ga0466692_041935 3300042591 Bacteria 3707
114 Ga0466692_203160 3300042591 Bacteria 1949
115 Ga0466699_110188 3300042597 Bacteria 9182
116 Ga0123356_10039586 3300010049 Bacteria 4392
117 AustNasuHG_c1007316 3300000089 Bacteria 3931
118 JGI24698J34947_10021243 3300002449 Unclassified 3494
119 JGI24695J34938_10001838 3300002450 Bacteria 17281
120 JGI24695J34938_10002063 3300002450 Bacteria 15781
121 JGI24695J34938_10002196 3300002450 Bacteria 15223
122 JGI24695J34938_10011034 3300002450 Bacteria 4900
123 JGI24695J34938_10012469 3300002450 Bacteria 4502
124 JGI24695J34938_10014025 3300002450 Bacteria 4177
125 Ga0466698_094281 3300042610 Bacteria 2529
126 Ga0466698_476846 3300042610 Bacteria 1111

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00950 ABC-3 ABC 3 transport family 37 296 0.97
PF01032 FecCD FecCD transport family 70 292 0.81

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.